Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017151093 756 bp mRNA linear INV 09-DEC-2024 (LOC108063844), transcript variant X2, mRNA. ACCESSION XM_017151093 VERSION XM_017151093.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017151093.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..756 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..756 /gene="LOC108063844" /note="uncharacterized LOC108063844; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108063844" CDS 16..618 /gene="LOC108063844" /codon_start=1 /product="uncharacterized protein isoform X2" /protein_id="XP_017006582.2" /db_xref="GeneID:108063844" /translation="MTTCSVVSTPARFASCLVNFQMDELLLLKRSVMRMESLDEDSLP DEDVVFPMPETNGSESQLPERMALMAADRGEHHDTTGGSTGPWHSHPPPHPPTSWAEQ KPSKLQTLFQISITALAFLSFGGYLLCLIVQAIKSKGTTYFHPVATTSTSASNGNVKR IKVYRRSRRSPDLRFILLQQDYASYMKAVREQGGWRSMLT" ORIGIN 1 gctggctgca aaaacatgac tacctgcagt gtggtcagca cgccagcgcg cttcgccagc 61 tgcctggtca actttcagat ggacgagctg ctgctgctga agaggtccgt gatgcgaatg 121 gagtcgctgg acgaggacag tcttcccgat gaggatgtag tcttcccgat gccggagacg 181 aatggatcgg aatcgcagct cccggagcga atggccttga tggccgccga tcgcggcgag 241 caccacgaca ccaccggcgg ctccactggt ccctggcact cgcatccacc gccacatccg 301 ccgacctcct gggccgagca gaagccctcc aagctgcaga ccctcttcca aatcagcatc 361 acggccctcg ccttcctctc cttcggcggc tacctgctct gcctcattgt gcaggccatc 421 aagagcaagg gcaccaccta cttccatccg gtggccacga ccagcaccag tgcatccaat 481 gggaatgtga agcggatcaa ggtgtacaga cgcagcaggc ggagtcccga tctccgcttc 541 atcctgctgc agcaggacta cgcctcctac atgaaggccg tgcgggagca gggcggatgg 601 aggagcatgc tcacctagtg ggatcgtaga tctggttgcc gcggtgcgcc aggcgattgg 661 gtcccacctt gatgccgtac agggcgtact gatcctcggt catcgttccg tcgctgtgga 721 ttgataactg attagtaaat ggttctagta attact