Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017151093             756 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108063844), transcript variant X2, mRNA.
ACCESSION   XM_017151093
VERSION     XM_017151093.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017151093.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..756
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..756
                     /gene="LOC108063844"
                     /note="uncharacterized LOC108063844; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:108063844"
     CDS             16..618
                     /gene="LOC108063844"
                     /codon_start=1
                     /product="uncharacterized protein isoform X2"
                     /protein_id="XP_017006582.2"
                     /db_xref="GeneID:108063844"
                     /translation="MTTCSVVSTPARFASCLVNFQMDELLLLKRSVMRMESLDEDSLP
                     DEDVVFPMPETNGSESQLPERMALMAADRGEHHDTTGGSTGPWHSHPPPHPPTSWAEQ
                     KPSKLQTLFQISITALAFLSFGGYLLCLIVQAIKSKGTTYFHPVATTSTSASNGNVKR
                     IKVYRRSRRSPDLRFILLQQDYASYMKAVREQGGWRSMLT"
ORIGIN      
        1 gctggctgca aaaacatgac tacctgcagt gtggtcagca cgccagcgcg cttcgccagc
       61 tgcctggtca actttcagat ggacgagctg ctgctgctga agaggtccgt gatgcgaatg
      121 gagtcgctgg acgaggacag tcttcccgat gaggatgtag tcttcccgat gccggagacg
      181 aatggatcgg aatcgcagct cccggagcga atggccttga tggccgccga tcgcggcgag
      241 caccacgaca ccaccggcgg ctccactggt ccctggcact cgcatccacc gccacatccg
      301 ccgacctcct gggccgagca gaagccctcc aagctgcaga ccctcttcca aatcagcatc
      361 acggccctcg ccttcctctc cttcggcggc tacctgctct gcctcattgt gcaggccatc
      421 aagagcaagg gcaccaccta cttccatccg gtggccacga ccagcaccag tgcatccaat
      481 gggaatgtga agcggatcaa ggtgtacaga cgcagcaggc ggagtcccga tctccgcttc
      541 atcctgctgc agcaggacta cgcctcctac atgaaggccg tgcgggagca gggcggatgg
      601 aggagcatgc tcacctagtg ggatcgtaga tctggttgcc gcggtgcgcc aggcgattgg
      661 gtcccacctt gatgccgtac agggcgtact gatcctcggt catcgttccg tcgctgtgga
      721 ttgataactg attagtaaat ggttctagta attact