Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Adenosine deaminase acting on RNA


LOCUS       XM_017151083            1451 bp    mRNA    linear   INV 09-DEC-2024
            (Adar), transcript variant X11, mRNA.
ACCESSION   XM_017151083
VERSION     XM_017151083.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017151083.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1451
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1451
                     /gene="Adar"
                     /note="Adenosine deaminase acting on RNA; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 5 Proteins"
                     /db_xref="GeneID:108063839"
     CDS             5..1306
                     /gene="Adar"
                     /codon_start=1
                     /product="double-stranded RNA-specific editase Adar
                     isoform X4"
                     /protein_id="XP_017006572.1"
                     /db_xref="GeneID:108063839"
                     /translation="MLNSANNNSPQHPVSAPSDINMNGYNRKSPQKRRYEMPKYAVSP
                     KKKTCKERIPQPKNTVAMLNELRHGLIYKLESQTGPVHAPLFTISVEVDGQKYLGQGR
                     SKKVARIEAAATALRSFIQFKDGAVLSPLKPSGNLDFTSDEHLENGIENLSNKQLVEI
                     IEPLMLTEKKSNLTSLEQPTLRLQMFCMSQNVSKSAITVDGQKKVPDKGPVMLLYELF
                     NDVNFECINIDGAQNNCRFKMTVTINEKKFDGTGPSKKLAKNAAAKAALASLCNISYS
                     PMVVPQKNVPLPIDDKSSSMELPQIHADTIGRLVLEKFMEVIKGQEAYSRRKVLAGIV
                     MTENMNFCEAKVISVSTGTKCVSGEHMSVNGAVLNDSHAEIVSRRCLLKFLYAQLDLQ
                     CNQEKLAASCVQKSSPVRGRFQSKAVMEYRRGMACCRANAC"
     misc_feature    173..361
                     /gene="Adar"
                     /note="first double-stranded RNA binding motif of STRBP,
                     ILF3, RED1, RED2 and similar proteins; Region:
                     DSRM_STRBP_RED-like_rpt1; cd19865"
                     /db_xref="CDD:380694"
     misc_feature    order(173..175,182..187,194..199,203..205,245..250,
                     254..256,260..262,311..319,326..328)
                     /gene="Adar"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:380694"
     misc_feature    626..>766
                     /gene="Adar"
                     /note="double-stranded RNA binding motif (DSRM)
                     superfamily; Region: DSRM_SF; cl00054"
                     /db_xref="CDD:444671"
     misc_feature    905..>1195
                     /gene="Adar"
                     /note="Adenosine-deaminase (editase) domain; Region:
                     A_deamin; cl02661"
                     /db_xref="CDD:470647"
ORIGIN      
        1 agtcatgtta aacagcgcaa ataacaattc tccccagcac ccggtgagtg caccatctga
       61 tatcaacatg aacggatata accggaagtc gcctcaaaaa cggcgctatg agatgccaaa
      121 atatgctgta tcaccaaaaa agaaaacctg caaggagcgc attccgcagc caaagaatac
      181 ggtggcaatg ctgaatgagt taagacatgg actgatttac aaattggagt cacagactgg
      241 tccggtgcac gcacctttat ttacgatatc cgttgaggtc gatggacaga aatacttggg
      301 ccagggtcgc agtaaaaaag ttgcacgcat cgaggcagct gccacagcac tgcgaagctt
      361 tatacaattc aaggacggag ccgtcttgtc gccattgaag ccatcgggca acttggactt
      421 taccagcgat gaacatctag aaaatggtat tgaaaatttg tccaacaaac aattggtcga
      481 gatcattgag ccgttgatgt tgactgaaaa gaaatccaac cttacctcgc ttgaacaacc
      541 cacgttgcgt cttcaaatgt tttgcatgag tcagaatgtc agcaagagtg ccatcactgt
      601 tgacggtcaa aagaaggttc cggacaaggg tcccgtaatg ctgctctacg aattgttcaa
      661 cgatgttaat tttgaatgca ttaatattga cggagctcaa aacaattgtc gcttcaagat
      721 gaccgtcacg attaacgaaa agaagttcga tggaacaggt ccttccaaaa agctggcgaa
      781 aaatgctgcg gccaaagcgg cacttgcctc gttgtgcaac atttcctaca gtccaatggt
      841 ggtgccacaa aagaacgtac cccttccaat cgacgacaag tcgtcatcca tggagttgcc
      901 gcagatacat gccgatacga ttggacgcct ggttttggag aagttcatgg aagtaatcaa
      961 gggccaggag gcctactcgc gtcgaaaggt attggcgggc attgttatga ctgaaaacat
     1021 gaatttttgt gaagccaaag ttatttcagt ctcgacgggc accaagtgtg tcagcggcga
     1081 gcatatgagt gtgaacggag ctgtcctgaa cgattcccat gccgaaatag tgtctaggcg
     1141 ttgtctcctc aagttcttgt atgcacagct ggatcttcag tgcaatcagg aaaagctcgc
     1201 ggccagttgc gtacaaaaat cgagtccggt gaggggacga ttccagtcaa aagcagtgat
     1261 ggaatacaga cgtgggatgg cgtgctgcag ggccaacgct tgctgacaat gtcgtgctcg
     1321 gacaaaattg cacgatggaa catcgtgggt atacaaggct ccttgttgtc ttccataatt
     1381 gaaccagtgt acctgcattc gattgtgctg ggcagtttgc tgcacccaga gcacatgtac
     1441 cgtgcagtgt g