Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017151063 616 bp mRNA linear INV 09-DEC-2024 (LOC108063832), transcript variant X2, mRNA. ACCESSION XM_017151063 VERSION XM_017151063.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017151063.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..616 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..616 /gene="LOC108063832" /note="uncharacterized LOC108063832; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108063832" CDS 99..515 /gene="LOC108063832" /codon_start=1 /product="uncharacterized protein isoform X2" /protein_id="XP_017006552.2" /db_xref="GeneID:108063832" /translation="MCLILSLGCCGCSSPKPCHKNSKKQQQKQQQQEQHLQHQPKNYH SDIQLNELSPELSSINCQVTTSQPSLSPSLSPSLTALPHRIATSSTLSSWAGEEELCD MEDYDSRMPTRWTAWWLKGAAVEGDRKACHSTSIVS" polyA_site 616 /gene="LOC108063832" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 acggctctgg gctgtgttgc ctcagttgaa ggcacccagc gaagtgccgc gggtaaatcg 61 aaataaataa aaataaaaat taacaacagt ttcgaatcat gtgccttatc ctctccctcg 121 gctgctgcgg ctgctcctcc ccgaagccct gccacaagaa cagcaagaag caacaacaga 181 agcaacagca gcaggagcag cacttgcagc accagccgaa gaactaccac tcggatatcc 241 agctgaacga gctatcgccg gagctgtcct cgatcaactg ccaggtgacc accagtcagc 301 cttcgctgag tcccagcctc agtcccagtt tgacggctct gccccacagg atcgccacgt 361 cgagcaccct gagctcatgg gccggcgagg aggagctctg cgatatggag gactacgaca 421 gtcgcatgcc cacccgttgg acagcctggt ggctcaaagg tgccgccgtt gagggtgata 481 ggaaggcctg ccactccacc tcgatcgtat cctaacttcg acctcctcga acttcgagcc 541 aaaagaattc ctgtttaatt gaaattacat taatacattt atggaagttc tcgaaaaaac 601 gataaagctt ttaaaa