Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii translation initiation factor IF-2


LOCUS       XM_017151019             921 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108063808), mRNA.
ACCESSION   XM_017151019
VERSION     XM_017151019.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 18, 2021 this sequence version replaced XM_017151019.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..921
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..921
                     /gene="LOC108063808"
                     /note="translation initiation factor IF-2; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:108063808"
     CDS             1..921
                     /gene="LOC108063808"
                     /codon_start=1
                     /product="translation initiation factor IF-2"
                     /protein_id="XP_017006508.2"
                     /db_xref="GeneID:108063808"
                     /translation="MARCQSSLIGILVVLFLDQWASGQQFLPGPISGPIPRQQRSLFG
                     PGPPPGWSSGGLSHGGWNAPSFEFSHLPPSHSPHVTKDELLALLAAWKDVAVKPTTPA
                     PEPEPEEPEPEPETTPAPPPPPEDEDEPEPEAPAPEAPAGPPPGVPVTVSLPALVPIQ
                     LAAMWQQPAPGAAAGGLGPLGLGGLGLGGGIALNNLGGGGAAAAGAGAAAAGGGGAAA
                     GAAAAAARSGLARPRARARIGGRASSNAQPAIRFPVANPRSFTSNNYVAPRPRYYRDT
                     DTMRFNVMAPPPYQVANVQGPVQLVPAYWQ"
ORIGIN      
        1 atggccagat gtcagagcag cctgatcggg atcctggtgg tcctgttcct cgaccagtgg
       61 gccagcggcc agcagttcct gcccggtccc atctccggtc ccattccgcg ccagcagaga
      121 tcgctcttcg ggccgggtcc tccgcccggt tggagcagcg gtggcctcag ccacggcggc
      181 tggaacgctc ccagcttcga gttcagccac ctgccgccct cccacagccc gcatgtgacc
      241 aaggacgagc tgctggccct gctggccgcc tggaaggatg tggccgtgaa gcccacgacc
      301 ccggcgccgg aaccagagcc cgaggagccc gagcccgagc cggagaccac gccagccccg
      361 ccgccgccgc cggaggatga ggacgagccg gagcccgagg caccggcacc agaggctcca
      421 gctggtccac cgcccggcgt tcccgtcacc gtttccctgc ccgccctggt gcccatccaa
      481 ctggcggcca tgtggcagca gccggcgcca ggagcagcgg caggcggatt gggcccgttg
      541 gggctgggag gattgggcct gggcggaggc attgcgttga acaatctcgg aggaggagga
      601 gcagcggcag cgggagcagg agcagctgca gctggaggcg gaggagcagc cgccggagcc
      661 gcagcagccg cagcacgatc cggattggcc cgtcccaggg ctcgagcaag gatcggagga
      721 cgtgcgtcct ccaatgcgca gcccgccatt cgcttcccgg tggccaatcc gcgcagcttc
      781 acctccaaca actacgtggc gcccaggccg cgttactatc gggatacgga caccatgcgc
      841 ttcaacgtca tggctcctcc gccctatcag gtggccaatg tccagggccc cgttcaactg
      901 gtgcccgcct actggcaata g