Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017151017 645 bp mRNA linear INV 09-DEC-2024 (LOC108063806), mRNA. ACCESSION XM_017151017 VERSION XM_017151017.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017151017.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..645 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..645 /gene="LOC108063806" /note="uncharacterized LOC108063806; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108063806" CDS 113..511 /gene="LOC108063806" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_017006506.3" /db_xref="GeneID:108063806" /translation="MMAGRQVEVASDQLSTGGSCGGDPAGTKLGFLTRLDRLLRRWLP GYSFIRGKRRSPSETSMAGGGGGQQKAQGLRGGRRRQVDDRKQEVYLDTGIAKSEFCV QLETLLRQKLLQKQQALALEQQERRNNEHP" ORIGIN 1 ctttccgagc atcgaaacaa aacggtgaaa cagtgtttcc cccgtcccca aaaaacatca 61 gccagcatat atatttgtga aatacaaaac cccgaaaaat agaacaaatt ggatgatggc 121 cggtcggcag gtggaggtgg ccagtgatca gttatccacc ggtggcagtt gtggtgggga 181 cccagctggg accaagttgg gattcctgac ccgtttggac cgactgctcc gccgctggct 241 cccaggatac agtttcattc gcggcaagcg ccgttcgccg tcggaaacct cgatggccgg 301 cggcggagga ggccagcaga aggcacaggg actcagagga ggcaggagga ggcaggtgga 361 tgacaggaaa caggaggtct atctggacac tggcatagcc aagtctgagt tctgcgtcca 421 actggagacc ctgttgcgcc agaagctgct ccaaaagcag caggcattgg cattggagca 481 gcaggagcga cggaataacg agcacccata gatggccatt ccttttttca tttctataca 541 tatgtattcg ttatatattt ttcataccat ccatcaatca atcaatcgag gcgcctcatt 601 aaaattaatt agaaataatg accggcaaaa ccaagagttg tctgt