Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017151017             645 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108063806), mRNA.
ACCESSION   XM_017151017
VERSION     XM_017151017.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017151017.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..645
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..645
                     /gene="LOC108063806"
                     /note="uncharacterized LOC108063806; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108063806"
     CDS             113..511
                     /gene="LOC108063806"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_017006506.3"
                     /db_xref="GeneID:108063806"
                     /translation="MMAGRQVEVASDQLSTGGSCGGDPAGTKLGFLTRLDRLLRRWLP
                     GYSFIRGKRRSPSETSMAGGGGGQQKAQGLRGGRRRQVDDRKQEVYLDTGIAKSEFCV
                     QLETLLRQKLLQKQQALALEQQERRNNEHP"
ORIGIN      
        1 ctttccgagc atcgaaacaa aacggtgaaa cagtgtttcc cccgtcccca aaaaacatca
       61 gccagcatat atatttgtga aatacaaaac cccgaaaaat agaacaaatt ggatgatggc
      121 cggtcggcag gtggaggtgg ccagtgatca gttatccacc ggtggcagtt gtggtgggga
      181 cccagctggg accaagttgg gattcctgac ccgtttggac cgactgctcc gccgctggct
      241 cccaggatac agtttcattc gcggcaagcg ccgttcgccg tcggaaacct cgatggccgg
      301 cggcggagga ggccagcaga aggcacaggg actcagagga ggcaggagga ggcaggtgga
      361 tgacaggaaa caggaggtct atctggacac tggcatagcc aagtctgagt tctgcgtcca
      421 actggagacc ctgttgcgcc agaagctgct ccaaaagcag caggcattgg cattggagca
      481 gcaggagcga cggaataacg agcacccata gatggccatt ccttttttca tttctataca
      541 tatgtattcg ttatatattt ttcataccat ccatcaatca atcaatcgag gcgcctcatt
      601 aaaattaatt agaaataatg accggcaaaa ccaagagttg tctgt