PREDICTED: Drosophila takahashii uncharacterized protein

LOCUS       XM_017151016             503 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108063805), mRNA.
ACCESSION   XM_017151016
VERSION     XM_017151016.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017151016.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..503
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..503
                     /gene="LOC108063805"
                     /note="uncharacterized LOC108063805; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108063805"
     CDS             27..503
                     /gene="LOC108063805"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_017006505.1"
                     /db_xref="GeneID:108063805"
                     /translation="MKPPLETADEGEEDGEGHDHHEGDPRPLPYDFEKELIEKSNRHI
                     RLYETFVPVSRVYPLTRKFYAQFEQHQPPDPLGYLRHTWPEKQVERQRQLAKAVPLLE
                     SQVYGWLPLQSGERAAHLNFLHAPKLRCGMTVHGERLIADRITTRPPFNGLRFLLH"
     misc_feature    117..431
                     /gene="LOC108063805"
                     /note="FAM183A and FAM183B related; Region: FAM183;
                     pfam14886"
                     /db_xref="CDD:434286"
ORIGIN      
        1 gaaattgata gttcgagttg aaaaccatga agccgccact tgaaaccgcc gacgagggcg
       61 aggaggatgg cgagggacac gatcaccacg agggggatcc ccgaccgctg ccctacgact
      121 tcgaaaagga gctgatcgag aagtccaatc gacacatccg actctacgag accttcgttc
      181 cagtaagcag ggtctatcca ctcacccgca agttctacgc gcagttcgag caacatcagc
      241 cgccggatcc gctggggtac ctgcggcaca cttggccgga gaaacaggtg gagcgccaga
      301 ggcagctggc gaaggcggtt ccgctcctgg agtcgcaggt ttacggctgg ctgccgctcc
      361 aaagtggcga gcgggccgcc catctgaact tcctgcacgc cccgaaactg cggtgcggca
      421 tgactgttca cggggagcgg ttgatcgcgg acaggattac gacgcgacct cctttcaacg
      481 gactaagatt cctgctccac tag