Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017151011 1510 bp mRNA linear INV 09-DEC-2024 (Rab27), transcript variant X1, mRNA. ACCESSION XM_017151011 VERSION XM_017151011.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017151011.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1510 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1510 /gene="Rab27" /note="RAS oncogene family member Rab27; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108063801" CDS 742..1437 /gene="Rab27" /codon_start=1 /product="ras-related protein Rab-27A" /protein_id="XP_017006500.2" /db_xref="GeneID:108063801" /translation="MTGANIDYDYLLKFLVLGDSGVGKTCLLYQYTDGRFHTQFISTV GIDFREKRLLYNSRGRRHRIHLQIWDTAGQERFRSLTTAFYRDAMGFLLIFDLTSEKS FLETANWLSQLRTHAYSEDPDVVLCGNKCDLLQLRVVSRDQVAALCRRYRLPYIETSA CTGANVKEAVELLVGRVMERIENAACNREFSLLLTQSRCLPNIAYGQPDDLLRLHERR EEAPQRRGNCRNC" misc_feature 763..1284 /gene="Rab27" /note="Members of the P-loop NTPase domain superfamily are characterized by a conserved nucleotide phosphate-binding motif, also referred to as the Walker A motif (GxxxxGK[S/T], where x is any residue), and the Walker B motif (hhhh[D/E], where h is a...; Region: P-loop containing Nucleoside Triphosphate Hydrolases; cl38936" /db_xref="CDD:476819" misc_feature 793..816 /gene="Rab27" /note="G1 box; other site" /db_xref="CDD:206648" misc_feature order(799..819,958..960,1126..1131,1135..1137,1216..1224) /gene="Rab27" /note="GTP/Mg2+ binding site [chemical binding]; other site" /db_xref="CDD:206648" misc_feature 868..870 /gene="Rab27" /note="G2 box; other site" /db_xref="CDD:206648" misc_feature 880..888 /gene="Rab27" /note="Switch I region; other site" /db_xref="CDD:206648" misc_feature 949..960 /gene="Rab27" /note="G3 box; other site" /db_xref="CDD:206648" misc_feature order(955..960,1006..1011) /gene="Rab27" /note="Switch II region; other site" /db_xref="CDD:206648" misc_feature 1126..1137 /gene="Rab27" /note="G4 box; other site" /db_xref="CDD:206648" misc_feature 1216..1224 /gene="Rab27" /note="G5 box; other site" /db_xref="CDD:206648" ORIGIN 1 aatcttcatt tcaaaataaa gcagttatcg ttttcactgg caaaatttct tacactttat 61 atcaatttca aagtattttc aaattaattt tgatggaaat taataataca aatttgacac 121 aagcgtaaac ttacctgata ttcacaagtt ttaatttcat tccaagttga aggtccaaag 181 ctcctttcaa agctttctcc caaaggaaaa gatgttcgct aaacgggaaa accccttcaa 241 agtcctttca aagtccccgt gcaagttttg gctgaaagct gcgcttcagt tggcggccaa 301 atggcaggat tacacaggtt gcaggatagt ccgtgctggg cagcgcatgg caacaggtcg 361 ggcagcgcat cgcccgcatc cggagccaca tcctcggaat ctcaatctga atcgagattc 421 agtcgagtcg agtttgtttt cgttttggca gcaaatcatc gaaagtcggg ggaacgaact 481 cccgggcaga cgaattgcgc gcgctaaaaa taacggttgc ccgcctaatc cttcaatcct 541 ccaagcctcc aatcctccag catccttcat ccttcatcct tggagtgccg aaaccccgtt 601 tttttttggc gggcgttggg gcggaaatgc gtgccgcgcc tctgcaatta gcaattagcc 661 ggatccggtg agcaggcgga caagatgcgt ccgctgtcct gaactcagag caaccagaga 721 atcagagaac cagaagccag aatgacgggc gccaatatcg actacgacta cctgctcaag 781 ttcctggtcc tcggggactc cggcgtgggc aaaacctgcc tgctctacca gtacacggac 841 ggccggttcc acacccagtt catctccacc gtgggcatcg acttccgcga gaagcgactg 901 ttgtacaact cccgcgggcg gcggcaccgc atccacctgc agatctggga caccgccggc 961 caggagcgct tccggtcgct gacgacggcc ttctaccggg acgccatggg cttcctgctg 1021 atcttcgacc tgaccagcga gaagagcttc ctggagacgg ccaactggct gtcgcagctg 1081 cggacgcacg cctactcgga ggaccccgac gtggtgctct gcggcaacaa gtgcgacctg 1141 ctgcagctgc gcgtggtgag ccgcgaccag gtggcggcgc tctgccggcg ctaccggctg 1201 ccctacatcg agacgagcgc ctgcaccggg gcgaatgtga aggaggccgt cgagctgctc 1261 gtgggccgcg tcatggagcg gatcgagaac gcggcctgca accgggagtt ctccctgctg 1321 ctcacccagt cgcgctgcct cccgaacatc gcctacgggc agccggatga cctgctgcgc 1381 ctccacgagc ggcgggagga ggccccccag cggcggggga actgccgcaa ctgctaacta 1441 actaagctag atgggatcgg atataccatc tcgccctgct ttgttccttc tgtctcgttt 1501 ctgtcttgaa