Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii RAS oncogene family member Rab27


LOCUS       XM_017151011            1510 bp    mRNA    linear   INV 09-DEC-2024
            (Rab27), transcript variant X1, mRNA.
ACCESSION   XM_017151011
VERSION     XM_017151011.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017151011.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1510
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1510
                     /gene="Rab27"
                     /note="RAS oncogene family member Rab27; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:108063801"
     CDS             742..1437
                     /gene="Rab27"
                     /codon_start=1
                     /product="ras-related protein Rab-27A"
                     /protein_id="XP_017006500.2"
                     /db_xref="GeneID:108063801"
                     /translation="MTGANIDYDYLLKFLVLGDSGVGKTCLLYQYTDGRFHTQFISTV
                     GIDFREKRLLYNSRGRRHRIHLQIWDTAGQERFRSLTTAFYRDAMGFLLIFDLTSEKS
                     FLETANWLSQLRTHAYSEDPDVVLCGNKCDLLQLRVVSRDQVAALCRRYRLPYIETSA
                     CTGANVKEAVELLVGRVMERIENAACNREFSLLLTQSRCLPNIAYGQPDDLLRLHERR
                     EEAPQRRGNCRNC"
     misc_feature    763..1284
                     /gene="Rab27"
                     /note="Members of the P-loop NTPase domain superfamily are
                     characterized by a conserved nucleotide phosphate-binding
                     motif, also referred to as the Walker A motif
                     (GxxxxGK[S/T], where x is any residue), and the Walker B
                     motif (hhhh[D/E], where h is a...; Region: P-loop
                     containing Nucleoside Triphosphate Hydrolases; cl38936"
                     /db_xref="CDD:476819"
     misc_feature    793..816
                     /gene="Rab27"
                     /note="G1 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    order(799..819,958..960,1126..1131,1135..1137,1216..1224)
                     /gene="Rab27"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206648"
     misc_feature    868..870
                     /gene="Rab27"
                     /note="G2 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    880..888
                     /gene="Rab27"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206648"
     misc_feature    949..960
                     /gene="Rab27"
                     /note="G3 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    order(955..960,1006..1011)
                     /gene="Rab27"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206648"
     misc_feature    1126..1137
                     /gene="Rab27"
                     /note="G4 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    1216..1224
                     /gene="Rab27"
                     /note="G5 box; other site"
                     /db_xref="CDD:206648"
ORIGIN      
        1 aatcttcatt tcaaaataaa gcagttatcg ttttcactgg caaaatttct tacactttat
       61 atcaatttca aagtattttc aaattaattt tgatggaaat taataataca aatttgacac
      121 aagcgtaaac ttacctgata ttcacaagtt ttaatttcat tccaagttga aggtccaaag
      181 ctcctttcaa agctttctcc caaaggaaaa gatgttcgct aaacgggaaa accccttcaa
      241 agtcctttca aagtccccgt gcaagttttg gctgaaagct gcgcttcagt tggcggccaa
      301 atggcaggat tacacaggtt gcaggatagt ccgtgctggg cagcgcatgg caacaggtcg
      361 ggcagcgcat cgcccgcatc cggagccaca tcctcggaat ctcaatctga atcgagattc
      421 agtcgagtcg agtttgtttt cgttttggca gcaaatcatc gaaagtcggg ggaacgaact
      481 cccgggcaga cgaattgcgc gcgctaaaaa taacggttgc ccgcctaatc cttcaatcct
      541 ccaagcctcc aatcctccag catccttcat ccttcatcct tggagtgccg aaaccccgtt
      601 tttttttggc gggcgttggg gcggaaatgc gtgccgcgcc tctgcaatta gcaattagcc
      661 ggatccggtg agcaggcgga caagatgcgt ccgctgtcct gaactcagag caaccagaga
      721 atcagagaac cagaagccag aatgacgggc gccaatatcg actacgacta cctgctcaag
      781 ttcctggtcc tcggggactc cggcgtgggc aaaacctgcc tgctctacca gtacacggac
      841 ggccggttcc acacccagtt catctccacc gtgggcatcg acttccgcga gaagcgactg
      901 ttgtacaact cccgcgggcg gcggcaccgc atccacctgc agatctggga caccgccggc
      961 caggagcgct tccggtcgct gacgacggcc ttctaccggg acgccatggg cttcctgctg
     1021 atcttcgacc tgaccagcga gaagagcttc ctggagacgg ccaactggct gtcgcagctg
     1081 cggacgcacg cctactcgga ggaccccgac gtggtgctct gcggcaacaa gtgcgacctg
     1141 ctgcagctgc gcgtggtgag ccgcgaccag gtggcggcgc tctgccggcg ctaccggctg
     1201 ccctacatcg agacgagcgc ctgcaccggg gcgaatgtga aggaggccgt cgagctgctc
     1261 gtgggccgcg tcatggagcg gatcgagaac gcggcctgca accgggagtt ctccctgctg
     1321 ctcacccagt cgcgctgcct cccgaacatc gcctacgggc agccggatga cctgctgcgc
     1381 ctccacgagc ggcgggagga ggccccccag cggcggggga actgccgcaa ctgctaacta
     1441 actaagctag atgggatcgg atataccatc tcgccctgct ttgttccttc tgtctcgttt
     1501 ctgtcttgaa