Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017151006 856 bp mRNA linear INV 09-DEC-2024 (Ldaf1), mRNA. ACCESSION XM_017151006 VERSION XM_017151006.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017151006.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..856 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..856 /gene="Ldaf1" /note="Lipid droplet assembly factor 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108063795" CDS 142..783 /gene="Ldaf1" /codon_start=1 /product="uncharacterized protein Ldaf1" /protein_id="XP_017006495.3" /db_xref="GeneID:108063795" /translation="MAHSNKARKAAREANAQNAQKSAETRTQNPKQEPQKVETPGESS AGSPTADQFLESLLQTLYKSWLHVRRLAEFVMSELGGNDFLEAIAAWCARNPHIAICL LAGGLVFLLPFLIIFGFGIATMVMTFTGLLVLEGTLLTIVSMVFFACLGGFAIIVPLF GVAAVAAYFGFAQVYGLCDGMERHKSALVKFVRDQRSPPPAPASISEEPTSTT" misc_feature 349..666 /gene="Ldaf1" /note="Region: Promethin; pfam16015" /db_xref="CDD:464974" polyA_site 856 /gene="Ldaf1" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tgccgatatt tatttgttta tttattttgt ttttccttac tgttgctttt taatcaagca 61 aattaacccg gataacaaac tggacttttc acctgtgatg agcacggaaa ccgcctgaga 121 ctcccgcagc agccgcacaa catggctcac tcaaacaagg cgcgcaaagc ggccagagaa 181 gcgaatgccc agaatgccca gaagtcggcg gaaacgagaa cgcagaaccc gaaacaggag 241 ccccaaaagg tggaaacccc tggcgaaagc agtgcaggat cccccacagc cgaccaattc 301 ctggagagtc tgctccaaac cctctacaag tcatggcttc atgtgcgtcg cctggccgag 361 tttgtgatgt ccgaactggg cgggaatgac ttcctggagg ccatcgccgc ctggtgcgcc 421 cggaacccgc acatcgccat ctgcctgctg gccggcggcc tggtcttcct gctccccttc 481 ctcataatct tcggcttcgg catcgccacc atggtgatga ccttcactgg tctgctggtg 541 ctagaaggca ctctcctgac catcgtgtcc atggtgttct tcgcctgcct gggcgggttc 601 gccatcattg ttccactctt cggtgtggcc gccgtggccg cctatttcgg cttcgcccaa 661 gtctacgggc tctgcgacgg aatggagcgc cacaagagcg ctttggttaa gttcgtcagg 721 gatcagcgca gcccgccgcc tgctcctgcg tccatttccg aggaacccac ttcgactaca 781 taagcccatt ccccttgccc aacaaacata gttattaaac aaataaagac cagtgcttgg 841 atgtttccta aatgta