Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Lipid droplet assembly factor 1


LOCUS       XM_017151006             856 bp    mRNA    linear   INV 09-DEC-2024
            (Ldaf1), mRNA.
ACCESSION   XM_017151006
VERSION     XM_017151006.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017151006.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..856
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..856
                     /gene="Ldaf1"
                     /note="Lipid droplet assembly factor 1; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 3 Proteins"
                     /db_xref="GeneID:108063795"
     CDS             142..783
                     /gene="Ldaf1"
                     /codon_start=1
                     /product="uncharacterized protein Ldaf1"
                     /protein_id="XP_017006495.3"
                     /db_xref="GeneID:108063795"
                     /translation="MAHSNKARKAAREANAQNAQKSAETRTQNPKQEPQKVETPGESS
                     AGSPTADQFLESLLQTLYKSWLHVRRLAEFVMSELGGNDFLEAIAAWCARNPHIAICL
                     LAGGLVFLLPFLIIFGFGIATMVMTFTGLLVLEGTLLTIVSMVFFACLGGFAIIVPLF
                     GVAAVAAYFGFAQVYGLCDGMERHKSALVKFVRDQRSPPPAPASISEEPTSTT"
     misc_feature    349..666
                     /gene="Ldaf1"
                     /note="Region: Promethin; pfam16015"
                     /db_xref="CDD:464974"
     polyA_site      856
                     /gene="Ldaf1"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tgccgatatt tatttgttta tttattttgt ttttccttac tgttgctttt taatcaagca
       61 aattaacccg gataacaaac tggacttttc acctgtgatg agcacggaaa ccgcctgaga
      121 ctcccgcagc agccgcacaa catggctcac tcaaacaagg cgcgcaaagc ggccagagaa
      181 gcgaatgccc agaatgccca gaagtcggcg gaaacgagaa cgcagaaccc gaaacaggag
      241 ccccaaaagg tggaaacccc tggcgaaagc agtgcaggat cccccacagc cgaccaattc
      301 ctggagagtc tgctccaaac cctctacaag tcatggcttc atgtgcgtcg cctggccgag
      361 tttgtgatgt ccgaactggg cgggaatgac ttcctggagg ccatcgccgc ctggtgcgcc
      421 cggaacccgc acatcgccat ctgcctgctg gccggcggcc tggtcttcct gctccccttc
      481 ctcataatct tcggcttcgg catcgccacc atggtgatga ccttcactgg tctgctggtg
      541 ctagaaggca ctctcctgac catcgtgtcc atggtgttct tcgcctgcct gggcgggttc
      601 gccatcattg ttccactctt cggtgtggcc gccgtggccg cctatttcgg cttcgcccaa
      661 gtctacgggc tctgcgacgg aatggagcgc cacaagagcg ctttggttaa gttcgtcagg
      721 gatcagcgca gcccgccgcc tgctcctgcg tccatttccg aggaacccac ttcgactaca
      781 taagcccatt ccccttgccc aacaaacata gttattaaac aaataaagac cagtgcttgg
      841 atgtttccta aatgta