Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017151003 828 bp mRNA linear INV 09-DEC-2024 MAPK and MTOR activator 5 (Lamtor5), mRNA. ACCESSION XM_017151003 VERSION XM_017151003.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017151003.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..828 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..828 /gene="Lamtor5" /note="Late endosomal/lysosomal adaptor, MAPK and MTOR activator 5; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108063793" CDS 121..423 /gene="Lamtor5" /codon_start=1 /product="ragulator complex protein LAMTOR5" /protein_id="XP_017006492.3" /db_xref="GeneID:108063793" /translation="MEQQLEKVLAEIAARQDTVGALLANRQGLCLGTKGDIDPNVSGI GMAISEQVAKLERNTTVPPTICLYSGNKRCVIQKDGEITGVIFKQQTAASATAAGN" misc_feature 121..384 /gene="Lamtor5" /note="Ragulator complex protein LAMTOR5; Region: LAMTOR5; pfam16672" /db_xref="CDD:406957" polyA_site 828 /gene="Lamtor5" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 aaatcatcgc agtttgtcca cctctattgt cattgttttg gttcttttct tcctcttgct 61 ttgttttttt cactgcactt gctgttctac gttgtgaaat aaaagataaa agcctcgccc 121 atggagcagc aactggagaa ggtcttggcg gagatcgccg cgcgacagga cacggtgggc 181 gctctgctgg cgaatcgtca gggattgtgc ctgggcacca agggcgacat tgaccccaac 241 gtctccggca tcggaatggc catttccgag caggtggcca aactggagcg gaacaccacg 301 gttcctccca ccatctgcct gtacagcggc aacaaacgct gtgtgatcca gaaggatggc 361 gagatcacgg gcgtgatctt caagcagcag acggctgcat cggcgaccgc cgccggcaac 421 taacaggagc tggggcctca ggcgcaactc tcaggccaaa cacggaagtc aggatacgga 481 tgcaaagtca gatgcagaca ctacagatac aaatatatag atcatacata tatcttccaa 541 gacgcgcttt gctcgagtca gcgcctgtta catttgtctc tcgttctaac cgatgaaacc 601 acaaccattg ttttgtacga ctcgcatagc attaagcatt aagcattacc gattacgcat 661 aacgcactac gcattacgca ttaagcactg ctgttaatcg ccttgtctaa acctaaaacc 721 agcctagcgc tatcaccatg tacataaaga ctttgtacga ttaagctccc aaaagtgatc 781 gaagcatata cctatgtaca ccaattacaa ttacagcgat gaagcaaa