Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Late endosomal/lysosomal adaptor,


LOCUS       XM_017151003             828 bp    mRNA    linear   INV 09-DEC-2024
            MAPK and MTOR activator 5 (Lamtor5), mRNA.
ACCESSION   XM_017151003
VERSION     XM_017151003.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017151003.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..828
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..828
                     /gene="Lamtor5"
                     /note="Late endosomal/lysosomal adaptor, MAPK and MTOR
                     activator 5; Derived by automated computational analysis
                     using gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 Proteins"
                     /db_xref="GeneID:108063793"
     CDS             121..423
                     /gene="Lamtor5"
                     /codon_start=1
                     /product="ragulator complex protein LAMTOR5"
                     /protein_id="XP_017006492.3"
                     /db_xref="GeneID:108063793"
                     /translation="MEQQLEKVLAEIAARQDTVGALLANRQGLCLGTKGDIDPNVSGI
                     GMAISEQVAKLERNTTVPPTICLYSGNKRCVIQKDGEITGVIFKQQTAASATAAGN"
     misc_feature    121..384
                     /gene="Lamtor5"
                     /note="Ragulator complex protein LAMTOR5; Region: LAMTOR5;
                     pfam16672"
                     /db_xref="CDD:406957"
     polyA_site      828
                     /gene="Lamtor5"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aaatcatcgc agtttgtcca cctctattgt cattgttttg gttcttttct tcctcttgct
       61 ttgttttttt cactgcactt gctgttctac gttgtgaaat aaaagataaa agcctcgccc
      121 atggagcagc aactggagaa ggtcttggcg gagatcgccg cgcgacagga cacggtgggc
      181 gctctgctgg cgaatcgtca gggattgtgc ctgggcacca agggcgacat tgaccccaac
      241 gtctccggca tcggaatggc catttccgag caggtggcca aactggagcg gaacaccacg
      301 gttcctccca ccatctgcct gtacagcggc aacaaacgct gtgtgatcca gaaggatggc
      361 gagatcacgg gcgtgatctt caagcagcag acggctgcat cggcgaccgc cgccggcaac
      421 taacaggagc tggggcctca ggcgcaactc tcaggccaaa cacggaagtc aggatacgga
      481 tgcaaagtca gatgcagaca ctacagatac aaatatatag atcatacata tatcttccaa
      541 gacgcgcttt gctcgagtca gcgcctgtta catttgtctc tcgttctaac cgatgaaacc
      601 acaaccattg ttttgtacga ctcgcatagc attaagcatt aagcattacc gattacgcat
      661 aacgcactac gcattacgca ttaagcactg ctgttaatcg ccttgtctaa acctaaaacc
      721 agcctagcgc tatcaccatg tacataaaga ctttgtacga ttaagctccc aaaagtgatc
      781 gaagcatata cctatgtaca ccaattacaa ttacagcgat gaagcaaa