PREDICTED: Drosophila takahashii trypsin eta (LOC108063785), mRNA.

LOCUS       XM_017150994            1069 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017150994
VERSION     XM_017150994.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017150994.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1069
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1069
                     /gene="LOC108063785"
                     /note="trypsin eta; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 2 Proteins"
                     /db_xref="GeneID:108063785"
     CDS             58..936
                     /gene="LOC108063785"
                     /codon_start=1
                     /product="trypsin eta"
                     /protein_id="XP_017006483.2"
                     /db_xref="GeneID:108063785"
                     /translation="MTRLLLFWLLCLLTCGAAKEKDHHQARIINGSLARTEETRHLVS
                     IRLLRHDNNFGSGHICGGALIAPRKVLTAAHCLYNNQRKRFRRASEFVVVLGTLNRFE
                     RRNGTIVSPVDSMAYMHTFSPDSMRDDVGLLILRLGQPPGHLTVAPIQLAGQVTPPGR
                     LCQVAGWGRTEQSSLSNVLLTANVSTIRHQTCRMIYRSGLLPGMMCAGRLQGGTDSCQ
                     GDSGGPLVHEGRLVGVVSWGYGCAEPGLPGVYVDVEYYRQWIEERSGSALARISPGWL
                     LISGALLELAHFWSAW"
     misc_feature    139..843
                     /gene="LOC108063785"
                     /note="Trypsin-like serine protease; Many of these are
                     synthesized as inactive precursor zymogens that are
                     cleaved during limited proteolysis to generate their
                     active forms. Alignment contains also inactive enzymes
                     that have substitutions of the catalytic triad...; Region:
                     Tryp_SPc; cd00190"
                     /db_xref="CDD:238113"
     misc_feature    139..141
                     /gene="LOC108063785"
                     /note="cleavage site [active]"
                     /db_xref="CDD:238113"
     misc_feature    order(280..282,442..444,718..720)
                     /gene="LOC108063785"
                     /note="active site"
                     /db_xref="CDD:238113"
     misc_feature    order(700..702,763..765,769..771)
                     /gene="LOC108063785"
                     /note="substrate binding sites [chemical binding]; other
                     site"
                     /db_xref="CDD:238113"
ORIGIN      
        1 ttgttgggct ccagtctcta gattccgacg acagtttctt ctcacctgcg atctgcgatg
       61 actcggctgc tgctcttttg gctcctctgc ctcctcacct gcggggccgc caaggagaag
      121 gaccatcacc aggcgaggat catcaatggg agcctggcca ggacggagga gacgcgccac
      181 ctggtctcca ttcgcctgct gcggcacgac aacaacttcg gcagtggcca catctgcggc
      241 ggggctttga ttgcgcccag aaaggtcctc accgccgccc actgcctgta caacaatcag
      301 agaaagcgct ttcgccgggc cagcgagttc gtcgtggtcc tgggcacgct gaaccgcttt
      361 gagcggcgca acggcaccat cgtctcgccg gtggactcca tggcctacat gcacaccttc
      421 agtccggaca gcatgcgcga cgacgtgggc ctcctcatcc tgcgcttagg gcaacctccc
      481 ggccacctca ctgtggcgcc cattcagctg gcggggcagg tcactccgcc cgggaggctg
      541 tgccaggtgg ccggctgggg acgcacggag cagagctccc tgtccaacgt cctgctgacg
      601 gccaatgtga gcaccatacg gcaccagacc tgccgcatga tctacaggag cggcctgctg
      661 cccgggatga tgtgcgccgg gcggctgcag ggcggcaccg actcctgcca gggcgactcc
      721 ggcggtccgc tggtccacga ggggcggctg gtgggcgtgg tctcgtgggg ctacggctgc
      781 gcggagccgg gactgccggg cgtctatgtg gacgtggagt actatcgcca gtggatcgag
      841 gagcgcagcg ggtccgcgct ggccaggatc agtccgggat ggctcctgat cagtggtgct
      901 ctcttagaac tagctcattt ctggagtgcc tggtgaagct ataactaaat cactaactaa
      961 attaactatt atgattattt ttaagaaatt ttaatttact aaaaatcgat atgatcatgt
     1021 agatttctgg ttatgccaaa cccatatcgt ttttacatga aatacaagt