Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii RNA-binding motif,


LOCUS       XM_017150990             593 bp    mRNA    linear   INV 09-DEC-2024
            single-stranded-interacting protein 1 (LOC108063782), mRNA.
ACCESSION   XM_017150990
VERSION     XM_017150990.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017150990.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..593
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..593
                     /gene="LOC108063782"
                     /note="RNA-binding motif, single-stranded-interacting
                     protein 1; Derived by automated computational analysis
                     using gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 Proteins"
                     /db_xref="GeneID:108063782"
     CDS             98..442
                     /gene="LOC108063782"
                     /codon_start=1
                     /product="RNA-binding motif, single-stranded-interacting
                     protein 1"
                     /protein_id="XP_017006479.2"
                     /db_xref="GeneID:108063782"
                     /translation="MSETVMAGILLANGPTRLKSRILVRNLPPNCSRVELAKVCECFG
                     KILGSRIDGTEGFVQFASESEAENAIEALDKSYFKSHLLDVSNASYRSQKERTQDLPL
                     ALSLKSANARHL"
     misc_feature    158..352
                     /gene="LOC108063782"
                     /note="RNA recognition motif; Region: RRM; smart00360"
                     /db_xref="CDD:214636"
ORIGIN      
        1 aagcacaacc tttggtcaga ctggcgatta caaaatcttt ttcttttgat attcaacgag
       61 agcctacgat tctacgatta tttattaaac gtcaataatg tctgaaacgg ttatggctgg
      121 cattttactt gcaaatggcc cgactcgcct gaagagcagg atccttgtgc gaaaccttcc
      181 gccgaattgc agccgcgtag agctggctaa agtgtgcgaa tgttttggca aaattcttgg
      241 ctcgcggatc gatggaaccg agggctttgt tcagtttgcc agcgagagtg aggccgagaa
      301 cgccatcgag gcactggaca aatcctactt caaatcgcac ctcctcgatg tctcgaatgc
      361 aagctaccga tcccaaaagg aaagaaccca agacctaccc ctagcgctaa gtttaaagag
      421 tgcgaatgcg aggcatctct agagcgtatt tatggagaga aggacaaaga ccagaaccag
      481 tagacctcca gtgcatttgc gttccacttt gaacataagc attaattagc agatagtttc
      541 ggctaattcc cataatcgta aaaattcgaa caataataat aattcttaaa act