Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii trypsin II-P29 (LOC108063779),


LOCUS       XM_017150987             941 bp    mRNA    linear   INV 09-DEC-2024
            mRNA.
ACCESSION   XM_017150987
VERSION     XM_017150987.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017150987.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..941
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..941
                     /gene="LOC108063779"
                     /note="trypsin II-P29; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 3 Proteins"
                     /db_xref="GeneID:108063779"
     CDS             18..809
                     /gene="LOC108063779"
                     /codon_start=1
                     /product="trypsin II-P29"
                     /protein_id="XP_017006476.2"
                     /db_xref="GeneID:108063779"
                     /translation="MATTVESSSSPLHLILLANALIRCGAYALAQGTRVQQENFGYVL
                     QIYDPKFLAAGSLFSARYILTVAHCFRSNTKPEELTVRAGSEWISREFRGKPVAGLQR
                     HPKFSPLTLRNDIAVLRVKVAIGYSRRINYIALCSAPLRRDKGANRLTIAGWNLVNIS
                     QPLKSLEVSVEMEKNCRLWFPQLPGGVSCASFAAGNGDGLCYGDSGDPLITAGGGEIC
                     GLAIAFRRCGDKRYPALFTDVHYHRQFIAQAVLTLDREMLKRPRG"
     misc_feature    111..761
                     /gene="LOC108063779"
                     /note="Trypsin-like serine protease; Many of these are
                     synthesized as inactive precursor zymogens that are
                     cleaved during limited proteolysis to generate their
                     active forms. Alignment contains also inactive enzymes
                     that have substitutions of the catalytic triad...; Region:
                     Tryp_SPc; cl21584"
                     /db_xref="CDD:473915"
     misc_feature    order(219..221,357..359,630..632)
                     /gene="LOC108063779"
                     /note="active site"
                     /db_xref="CDD:238113"
ORIGIN      
        1 ttacttgtac gaatgagatg gcaaccacag tggagtcgtc gtcgtcgccg ctgcatctga
       61 tcctccttgc gaacgcgttg atcagatgcg gagcatatgc actagctcag ggaacgagag
      121 tgcagcagga gaactttggc tatgtgctgc agatctacga tccaaagttc ctggcggccg
      181 gttccttgtt cagtgcccgt tacattttga cggtggctca ctgttttcgc agtaacacca
      241 agccggagga gctgacagtg cgagcgggtt ccgagtggat atcgagggag tttaggggca
      301 agccagtggc gggattgcag cgccatccga aattctcgcc cctaacgctg cgcaacgata
      361 ttgccgtgct gcgggtcaaa gtggccattg gatattcgcg tcgcatcaac tatatagctc
      421 tctgttcggc gcccttgaga cgcgataagg gcgccaatcg tttgacgatc gccggttgga
      481 atctggtgaa tatcagccag ccgctaaaat cgcttgaagt cagcgtggag atggagaaaa
      541 actgccgcct ttggtttccc cagctgccgg gcggcgtgtc ctgcgcctcg tttgctgcgg
      601 gaaacggcga tggtttatgc tatggcgact ccggggatcc cctgatcacc gccggcggtg
      661 gtgaaatctg tggcctggca attgcctttc ggagatgtgg cgacaagcga tatcccgccc
      721 tcttcaccga tgtccactac catcggcaat tcatcgccca agccgtactc acattggaca
      781 gggaaatgtt gaagaggcca aggggttgaa ctctctttat acgtgatcca ttatggttta
      841 aaaaactcac ctgcaaggaa acagacagag gaaaattcaa ttacaatcga gtgatgaact
      901 gatattaaga ggcgcagatg aaagatttaa ttataataat t