Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017150987 941 bp mRNA linear INV 09-DEC-2024 mRNA. ACCESSION XM_017150987 VERSION XM_017150987.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017150987.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..941 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..941 /gene="LOC108063779" /note="trypsin II-P29; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108063779" CDS 18..809 /gene="LOC108063779" /codon_start=1 /product="trypsin II-P29" /protein_id="XP_017006476.2" /db_xref="GeneID:108063779" /translation="MATTVESSSSPLHLILLANALIRCGAYALAQGTRVQQENFGYVL QIYDPKFLAAGSLFSARYILTVAHCFRSNTKPEELTVRAGSEWISREFRGKPVAGLQR HPKFSPLTLRNDIAVLRVKVAIGYSRRINYIALCSAPLRRDKGANRLTIAGWNLVNIS QPLKSLEVSVEMEKNCRLWFPQLPGGVSCASFAAGNGDGLCYGDSGDPLITAGGGEIC GLAIAFRRCGDKRYPALFTDVHYHRQFIAQAVLTLDREMLKRPRG" misc_feature 111..761 /gene="LOC108063779" /note="Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms. Alignment contains also inactive enzymes that have substitutions of the catalytic triad...; Region: Tryp_SPc; cl21584" /db_xref="CDD:473915" misc_feature order(219..221,357..359,630..632) /gene="LOC108063779" /note="active site" /db_xref="CDD:238113" ORIGIN 1 ttacttgtac gaatgagatg gcaaccacag tggagtcgtc gtcgtcgccg ctgcatctga 61 tcctccttgc gaacgcgttg atcagatgcg gagcatatgc actagctcag ggaacgagag 121 tgcagcagga gaactttggc tatgtgctgc agatctacga tccaaagttc ctggcggccg 181 gttccttgtt cagtgcccgt tacattttga cggtggctca ctgttttcgc agtaacacca 241 agccggagga gctgacagtg cgagcgggtt ccgagtggat atcgagggag tttaggggca 301 agccagtggc gggattgcag cgccatccga aattctcgcc cctaacgctg cgcaacgata 361 ttgccgtgct gcgggtcaaa gtggccattg gatattcgcg tcgcatcaac tatatagctc 421 tctgttcggc gcccttgaga cgcgataagg gcgccaatcg tttgacgatc gccggttgga 481 atctggtgaa tatcagccag ccgctaaaat cgcttgaagt cagcgtggag atggagaaaa 541 actgccgcct ttggtttccc cagctgccgg gcggcgtgtc ctgcgcctcg tttgctgcgg 601 gaaacggcga tggtttatgc tatggcgact ccggggatcc cctgatcacc gccggcggtg 661 gtgaaatctg tggcctggca attgcctttc ggagatgtgg cgacaagcga tatcccgccc 721 tcttcaccga tgtccactac catcggcaat tcatcgccca agccgtactc acattggaca 781 gggaaatgtt gaagaggcca aggggttgaa ctctctttat acgtgatcca ttatggttta 841 aaaaactcac ctgcaaggaa acagacagag gaaaattcaa ttacaatcga gtgatgaact 901 gatattaaga ggcgcagatg aaagatttaa ttataataat t