Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017150645 762 bp mRNA linear INV 09-DEC-2024 (LOC108063525), mRNA. ACCESSION XM_017150645 VERSION XM_017150645.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017150645.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..762 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..762 /gene="LOC108063525" /note="COMM domain-containing protein 3; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108063525" CDS 85..696 /gene="LOC108063525" /codon_start=1 /product="COMM domain-containing protein 3" /protein_id="XP_017006134.2" /db_xref="GeneID:108063525" /translation="MASSPALDAEPSLLSATVVAGLKNLGAIISPPLTKLLIANSLKL TLHPDATIAPVPEIYANNAACAKQSEYAVVTLYAVATKHNWDGMQLRQQLEQLDSLDA SAIDELCRVYEDNRRELLLRQLQVGHSFPHITDIQWRIVCDVKSSTSDCSSGVASFHI NLGNFRPSSGERETIVEFVCNAEELQSLINRLKEIERHCSQVA" misc_feature 400..693 /gene="LOC108063525" /note="COMM_Domain containing protein 3. The COMM Domain is found at the C-terminus of a variety of proteins; presumably all COMM_Domain containing proteins are located in the nucleus and the COMM domain plays a role in protein-protein interactions. Several...; Region: Commd3; cd04751" /db_xref="CDD:240099" polyA_site 762 /gene="LOC108063525" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ttgtttacaa ccggtccaat tgatttatcc tcgttgcttt aagcttaatc tcgtccgatc 61 ttggaaggat ttgggctgac agtcatggcc agctccccag ccttggatgc agagcccagc 121 ctgctctcgg ccaccgtggt ggcgggtcta aagaacctgg gagccatcat ctcgccgccg 181 ctgaccaagt tgctcattgc gaactcgctg aaactgaccc ttcatccgga tgccacaatt 241 gctcccgtgc ccgagatcta tgccaacaat gccgcctgcg ccaaacagag cgagtacgcg 301 gtggtcaccc tctacgcggt ggccaccaag cacaactggg atgggatgca gttgcgccag 361 cagctggagc aactggattc gctggacgcc agcgccattg acgaactgtg ccgcgtgtac 421 gaggacaatc gcagggagct cctcctccgg cagctgcagg tgggccacag ttttccgcac 481 atcaccgaca tccagtggcg catcgtctgc gacgtcaagt cctccacctc cgactgcagc 541 tcgggcgtgg ccagcttcca catcaatctg ggcaacttcc ggccgagcag cggcgagcgg 601 gagacgatcg tggagttcgt ttgcaacgcc gaggagctgc agtcgctgat caataggctc 661 aaggagatcg agcggcactg cagccaggtg gcctaatctc tactttcaac aactcttatc 721 caatatattt cgcagcatat ataacacaag ctatatacag tg