Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii COMM domain-containing protein 3


LOCUS       XM_017150645             762 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108063525), mRNA.
ACCESSION   XM_017150645
VERSION     XM_017150645.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017150645.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..762
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..762
                     /gene="LOC108063525"
                     /note="COMM domain-containing protein 3; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 3 Proteins"
                     /db_xref="GeneID:108063525"
     CDS             85..696
                     /gene="LOC108063525"
                     /codon_start=1
                     /product="COMM domain-containing protein 3"
                     /protein_id="XP_017006134.2"
                     /db_xref="GeneID:108063525"
                     /translation="MASSPALDAEPSLLSATVVAGLKNLGAIISPPLTKLLIANSLKL
                     TLHPDATIAPVPEIYANNAACAKQSEYAVVTLYAVATKHNWDGMQLRQQLEQLDSLDA
                     SAIDELCRVYEDNRRELLLRQLQVGHSFPHITDIQWRIVCDVKSSTSDCSSGVASFHI
                     NLGNFRPSSGERETIVEFVCNAEELQSLINRLKEIERHCSQVA"
     misc_feature    400..693
                     /gene="LOC108063525"
                     /note="COMM_Domain containing protein 3. The COMM Domain
                     is found at the C-terminus of a variety of proteins;
                     presumably all COMM_Domain containing proteins are located
                     in the nucleus and the COMM domain plays a role in
                     protein-protein interactions. Several...; Region: Commd3;
                     cd04751"
                     /db_xref="CDD:240099"
     polyA_site      762
                     /gene="LOC108063525"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttgtttacaa ccggtccaat tgatttatcc tcgttgcttt aagcttaatc tcgtccgatc
       61 ttggaaggat ttgggctgac agtcatggcc agctccccag ccttggatgc agagcccagc
      121 ctgctctcgg ccaccgtggt ggcgggtcta aagaacctgg gagccatcat ctcgccgccg
      181 ctgaccaagt tgctcattgc gaactcgctg aaactgaccc ttcatccgga tgccacaatt
      241 gctcccgtgc ccgagatcta tgccaacaat gccgcctgcg ccaaacagag cgagtacgcg
      301 gtggtcaccc tctacgcggt ggccaccaag cacaactggg atgggatgca gttgcgccag
      361 cagctggagc aactggattc gctggacgcc agcgccattg acgaactgtg ccgcgtgtac
      421 gaggacaatc gcagggagct cctcctccgg cagctgcagg tgggccacag ttttccgcac
      481 atcaccgaca tccagtggcg catcgtctgc gacgtcaagt cctccacctc cgactgcagc
      541 tcgggcgtgg ccagcttcca catcaatctg ggcaacttcc ggccgagcag cggcgagcgg
      601 gagacgatcg tggagttcgt ttgcaacgcc gaggagctgc agtcgctgat caataggctc
      661 aaggagatcg agcggcactg cagccaggtg gcctaatctc tactttcaac aactcttatc
      721 caatatattt cgcagcatat ataacacaag ctatatacag tg