Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Gustatory receptor 8a (Gr8a),


LOCUS       XM_017150639            1304 bp    mRNA    linear   INV 09-DEC-2024
            mRNA.
ACCESSION   XM_017150639
VERSION     XM_017150639.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017150639.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1304
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1304
                     /gene="Gr8a"
                     /note="Gustatory receptor 8a; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:108063519"
     CDS             22..1254
                     /gene="Gr8a"
                     /codon_start=1
                     /product="gustatory receptor 8a"
                     /protein_id="XP_017006128.2"
                     /db_xref="GeneID:108063519"
                     /translation="MVLKRRSGLQIIPFRWEKSPRAEQSTMSGRLGRVLRFHLRLYQV
                     LGFHGLPLPGDGSPARMRRQLMAWSLFLLVSLSGLIIMCLTSGEEFLYRGDAFGCVND
                     ALKYVFAQLAVAAIYLETLSSQRHLANFWWLHSKLNGQHFQASLRSECQQHRRYLISL
                     YAMMCAELLLHLGLWQVQPLTNHMLLFWSTYEPLVCLTYMRNIQFVMHLELVREQLIA
                     LERELGLLAEYSRFASETGRSFPNFEGFLRRRLRQKQLIYSDVYDMLRCFLGAFNFSI
                     LAVLLTINIRIAVDCYFMYYSIYNNVVNIDYYLILPALLEIPAFIYASQSCMVIVPRI
                     AHQLHNIVTDSGCCSCPDLSLQIQNFSLQLLHQPMRIDCLGLTTLDCSLLTRIACSVG
                     TYMIYTIQFIPKFSNQYS"
     misc_feature    124..1224
                     /gene="Gr8a"
                     /note="7tm Chemosensory receptor; Region: 7tm_7;
                     pfam08395"
                     /db_xref="CDD:462463"
ORIGIN      
        1 cttaagcacc cacttaggct aatggtatta aagcgcagat cgggcctcca gataattccc
       61 tttcgatggg aaaagtctcc ccgcgccgaa cagtccacga tgagcggccg tctgggtcgc
      121 gtcctgcggt tccacctgcg gctctaccag gtgctcggct tccatggact gcccctgccg
      181 ggcgacggca gtccggcgag gatgcggagg cagctgatgg cctggagcct gttcctgctg
      241 gtctcgctga gcggcctgat catcatgtgc ctgaccagcg gcgaggagtt cctctatcgc
      301 ggcgatgcct tcggctgtgt gaatgatgcc ttgaaatacg tattcgccca gttggccgtg
      361 gctgctattt atctggagac gctgagcagc cagcggcatt tggccaactt ctggtggctg
      421 cactccaagc tgaatgggca gcacttccag gcgagcctgc gcagcgagtg ccagcagcac
      481 cgtcgctacc taatctccct gtacgccatg atgtgcgccg agctgctgct ccatttgggc
      541 ttgtggcagg tgcagccgct gaccaaccac atgctcctct tctggagcac ctacgagccg
      601 ctcgtctgcc tcacgtacat gcggaacatt cagtttgtga tgcatctgga gctggtgagg
      661 gagcagttga ttgccctgga gcgggaactc ggcctcctgg cggagtactc ccggtttgcc
      721 agcgaaactg gaaggagttt tcccaacttc gagggtttcc tgcgacgacg actgcgccaa
      781 aagcagctca tctacagcga tgtgtacgac atgctcaggt gcttcctcgg cgccttcaac
      841 ttctccattc tggccgtcct gctgaccatc aacatccgga tcgccgtgga ctgctacttc
      901 atgtactaca gcatatataa taatgtggtt aatatagact actatttaat cttgcccgcc
      961 ttgctggaga tccccgcctt catttacgcc tcgcagagct gcatggtcat tgtgccgcgg
     1021 attgcccacc agttgcacaa catagtcacc gattccggct gctgcagctg ccccgatctc
     1081 tccctgcaga ttcaaaactt ttcgctgcaa ctgctgcatc agccgatgcg aatcgattgc
     1141 ctgggtttga ccactctaga ttgcagtctt cttacgcgga ttgcctgttc ggtgggcacc
     1201 tacatgatct acaccatcca gtttatacca aagttcagca atcagtactc gtagaaaagg
     1261 attacatatt acacagtcaa cttaagggtg ctaaaaacaa acct