Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017150639 1304 bp mRNA linear INV 09-DEC-2024 mRNA. ACCESSION XM_017150639 VERSION XM_017150639.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017150639.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1304 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1304 /gene="Gr8a" /note="Gustatory receptor 8a; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108063519" CDS 22..1254 /gene="Gr8a" /codon_start=1 /product="gustatory receptor 8a" /protein_id="XP_017006128.2" /db_xref="GeneID:108063519" /translation="MVLKRRSGLQIIPFRWEKSPRAEQSTMSGRLGRVLRFHLRLYQV LGFHGLPLPGDGSPARMRRQLMAWSLFLLVSLSGLIIMCLTSGEEFLYRGDAFGCVND ALKYVFAQLAVAAIYLETLSSQRHLANFWWLHSKLNGQHFQASLRSECQQHRRYLISL YAMMCAELLLHLGLWQVQPLTNHMLLFWSTYEPLVCLTYMRNIQFVMHLELVREQLIA LERELGLLAEYSRFASETGRSFPNFEGFLRRRLRQKQLIYSDVYDMLRCFLGAFNFSI LAVLLTINIRIAVDCYFMYYSIYNNVVNIDYYLILPALLEIPAFIYASQSCMVIVPRI AHQLHNIVTDSGCCSCPDLSLQIQNFSLQLLHQPMRIDCLGLTTLDCSLLTRIACSVG TYMIYTIQFIPKFSNQYS" misc_feature 124..1224 /gene="Gr8a" /note="7tm Chemosensory receptor; Region: 7tm_7; pfam08395" /db_xref="CDD:462463" ORIGIN 1 cttaagcacc cacttaggct aatggtatta aagcgcagat cgggcctcca gataattccc 61 tttcgatggg aaaagtctcc ccgcgccgaa cagtccacga tgagcggccg tctgggtcgc 121 gtcctgcggt tccacctgcg gctctaccag gtgctcggct tccatggact gcccctgccg 181 ggcgacggca gtccggcgag gatgcggagg cagctgatgg cctggagcct gttcctgctg 241 gtctcgctga gcggcctgat catcatgtgc ctgaccagcg gcgaggagtt cctctatcgc 301 ggcgatgcct tcggctgtgt gaatgatgcc ttgaaatacg tattcgccca gttggccgtg 361 gctgctattt atctggagac gctgagcagc cagcggcatt tggccaactt ctggtggctg 421 cactccaagc tgaatgggca gcacttccag gcgagcctgc gcagcgagtg ccagcagcac 481 cgtcgctacc taatctccct gtacgccatg atgtgcgccg agctgctgct ccatttgggc 541 ttgtggcagg tgcagccgct gaccaaccac atgctcctct tctggagcac ctacgagccg 601 ctcgtctgcc tcacgtacat gcggaacatt cagtttgtga tgcatctgga gctggtgagg 661 gagcagttga ttgccctgga gcgggaactc ggcctcctgg cggagtactc ccggtttgcc 721 agcgaaactg gaaggagttt tcccaacttc gagggtttcc tgcgacgacg actgcgccaa 781 aagcagctca tctacagcga tgtgtacgac atgctcaggt gcttcctcgg cgccttcaac 841 ttctccattc tggccgtcct gctgaccatc aacatccgga tcgccgtgga ctgctacttc 901 atgtactaca gcatatataa taatgtggtt aatatagact actatttaat cttgcccgcc 961 ttgctggaga tccccgcctt catttacgcc tcgcagagct gcatggtcat tgtgccgcgg 1021 attgcccacc agttgcacaa catagtcacc gattccggct gctgcagctg ccccgatctc 1081 tccctgcaga ttcaaaactt ttcgctgcaa ctgctgcatc agccgatgcg aatcgattgc 1141 ctgggtttga ccactctaga ttgcagtctt cttacgcgga ttgcctgttc ggtgggcacc 1201 tacatgatct acaccatcca gtttatacca aagttcagca atcagtactc gtagaaaagg 1261 attacatatt acacagtcaa cttaagggtg ctaaaaacaa acct