Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017150630 1548 bp mRNA linear INV 09-DEC-2024 (Aladin), mRNA. ACCESSION XM_017150630 VERSION XM_017150630.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017150630.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1548 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1548 /gene="Aladin" /note="aladin WD repeat nucleoporin; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108063512" CDS 72..1478 /gene="Aladin" /codon_start=1 /product="aladin" /protein_id="XP_017006119.2" /db_xref="GeneID:108063512" /translation="MAALSNLKQCPPFSTLPDLALRHNHIPELERYPQINLNSELMAN PGAQRFYGGQSFVPVDEGVLKRITRTFFDGGFWESLEEARSPKSREQAPLIAQAGDLI ARILGLATGLRLKILPHTQELSAERIAQFVETRDWLNSDVRFLAWNCHFFSLAVAGVD DVVRIYSKNSNAATATILKSPTQTQITCMAWRPLCAAEIVIGCRQGLCFWEVDSSLHL GRTNAPSKLFKHPANLPITSLQWNKDGTQLATASIGDRSIIVWQPDNGMMQPLKRLGP PGSLLKWSPDNDWLFAATVDRVFRVWNCHQQWTTERWVCGPGGHVQTACWSPCGRFLL FVSSAEPILYRLQFVQQSLLSSSADEKEILPIADLNACSIDANRTLIGGPAQQLAWDP HGNYLVVTFKSTNCIAVFRTFVQKFDLQISAAYYLSGETATEHPSFICFQPLYKDNDR SVLTIAWSSGRIQYYAFD" misc_feature 498..614 /gene="Aladin" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature <531..1085 /gene="Aladin" /note="WD40 repeat [General function prediction only]; Region: WD40; COG2319" /db_xref="CDD:441893" misc_feature 627..758 /gene="Aladin" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 780..899 /gene="Aladin" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 903..1025 /gene="Aladin" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 1035..1148 /gene="Aladin" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 1167..1277 /gene="Aladin" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 1296..1400 /gene="Aladin" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" polyA_site 1548 /gene="Aladin" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 taattaccgc gcattttgcc gcatcttgtt agcaatttcg gaattgaact aaatgtgaat 61 taaccgaaat aatggcggcc ctgagcaacc tgaagcagtg cccgccgttc tccacgctgc 121 ccgatctggc gctgcggcac aaccacatcc ccgagctgga gcgctatccg cagatcaacc 181 tgaacagcga attgatggcc aatccgggcg cccagagatt ctacggcggc cagagcttcg 241 tgcccgtgga tgagggcgtc ctgaagcgca tcacccgcac cttcttcgac ggcggcttct 301 gggagtcgct ggaggaggcg cgcagcccca agagccgcga gcaggcgccc ctgattgccc 361 aggcgggtga tttgatagcc aggatcttgg gtctggccac cggactgcgg ctgaagatcc 421 tcccgcacac ccaggagctc agtgccgagc ggatagcgca gtttgtggag accagggatt 481 ggctgaacag cgatgtgcgc ttcctcgcct ggaactgcca cttcttcagc ctggccgtcg 541 ccggcgtgga cgatgtggtg cgcatctact caaagaattc caacgcggcc accgccacta 601 ttttgaagag ccccactcaa acgcagatca cctgcatggc gtggcgtccg ctctgcgcgg 661 cggagatagt gattggctgt cggcagggtc tttgcttctg ggaagtggac agcagcctgc 721 acctgggacg caccaatgcg cccagcaagc tttttaagca tcccgccaat ctgccaatta 781 cctcgctgca gtggaacaag gacggcaccc agctggccac cgcctcgatt ggcgatcgat 841 ccatcatcgt ctggcagccg gacaacggaa tgatgcagcc gctgaagcgc ctgggtccgc 901 cgggctcgct gctcaagtgg tcgccggaca acgactggct gttcgcggcc accgttgacc 961 gggtgttccg cgtgtggaac tgccaccagc agtggacgac ggagcgctgg gtgtgcggac 1021 ccggtggcca tgtgcagaca gcctgctggt cgccctgcgg tcgcttcctg ctcttcgtca 1081 gcagcgccga accgattctc tatcgcctgc agttcgtgca gcagagtctg ctctcgtctt 1141 cggcggatga gaaggaaatt ctgcccatcg cggatttaaa cgcctgcagc atcgatgcga 1201 atcgcacgct catcggcggt cccgcccagc agctggcttg ggatccgcat gggaactacc 1261 tcgtggtcac cttcaagtcg accaactgca tcgccgtttt ccgcaccttc gtccagaagt 1321 tcgatctgca gatctcggcg gcgtattatc tgagcggaga gacggcaacg gagcatccca 1381 gcttcatctg cttccagccg ctgtacaagg acaacgatcg atccgttctg acgatcgcct 1441 ggtcgtcggg tcgtattcag tactacgcct tcgactgatg ttgttttcat tgtaatattt 1501 tatttgattt ggttttcgta agcgttaata cacagttaaa caggataa