Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii aladin WD repeat nucleoporin


LOCUS       XM_017150630            1548 bp    mRNA    linear   INV 09-DEC-2024
            (Aladin), mRNA.
ACCESSION   XM_017150630
VERSION     XM_017150630.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017150630.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1548
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1548
                     /gene="Aladin"
                     /note="aladin WD repeat nucleoporin; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108063512"
     CDS             72..1478
                     /gene="Aladin"
                     /codon_start=1
                     /product="aladin"
                     /protein_id="XP_017006119.2"
                     /db_xref="GeneID:108063512"
                     /translation="MAALSNLKQCPPFSTLPDLALRHNHIPELERYPQINLNSELMAN
                     PGAQRFYGGQSFVPVDEGVLKRITRTFFDGGFWESLEEARSPKSREQAPLIAQAGDLI
                     ARILGLATGLRLKILPHTQELSAERIAQFVETRDWLNSDVRFLAWNCHFFSLAVAGVD
                     DVVRIYSKNSNAATATILKSPTQTQITCMAWRPLCAAEIVIGCRQGLCFWEVDSSLHL
                     GRTNAPSKLFKHPANLPITSLQWNKDGTQLATASIGDRSIIVWQPDNGMMQPLKRLGP
                     PGSLLKWSPDNDWLFAATVDRVFRVWNCHQQWTTERWVCGPGGHVQTACWSPCGRFLL
                     FVSSAEPILYRLQFVQQSLLSSSADEKEILPIADLNACSIDANRTLIGGPAQQLAWDP
                     HGNYLVVTFKSTNCIAVFRTFVQKFDLQISAAYYLSGETATEHPSFICFQPLYKDNDR
                     SVLTIAWSSGRIQYYAFD"
     misc_feature    498..614
                     /gene="Aladin"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    <531..1085
                     /gene="Aladin"
                     /note="WD40 repeat [General function prediction only];
                     Region: WD40; COG2319"
                     /db_xref="CDD:441893"
     misc_feature    627..758
                     /gene="Aladin"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    780..899
                     /gene="Aladin"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    903..1025
                     /gene="Aladin"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    1035..1148
                     /gene="Aladin"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    1167..1277
                     /gene="Aladin"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    1296..1400
                     /gene="Aladin"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     polyA_site      1548
                     /gene="Aladin"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 taattaccgc gcattttgcc gcatcttgtt agcaatttcg gaattgaact aaatgtgaat
       61 taaccgaaat aatggcggcc ctgagcaacc tgaagcagtg cccgccgttc tccacgctgc
      121 ccgatctggc gctgcggcac aaccacatcc ccgagctgga gcgctatccg cagatcaacc
      181 tgaacagcga attgatggcc aatccgggcg cccagagatt ctacggcggc cagagcttcg
      241 tgcccgtgga tgagggcgtc ctgaagcgca tcacccgcac cttcttcgac ggcggcttct
      301 gggagtcgct ggaggaggcg cgcagcccca agagccgcga gcaggcgccc ctgattgccc
      361 aggcgggtga tttgatagcc aggatcttgg gtctggccac cggactgcgg ctgaagatcc
      421 tcccgcacac ccaggagctc agtgccgagc ggatagcgca gtttgtggag accagggatt
      481 ggctgaacag cgatgtgcgc ttcctcgcct ggaactgcca cttcttcagc ctggccgtcg
      541 ccggcgtgga cgatgtggtg cgcatctact caaagaattc caacgcggcc accgccacta
      601 ttttgaagag ccccactcaa acgcagatca cctgcatggc gtggcgtccg ctctgcgcgg
      661 cggagatagt gattggctgt cggcagggtc tttgcttctg ggaagtggac agcagcctgc
      721 acctgggacg caccaatgcg cccagcaagc tttttaagca tcccgccaat ctgccaatta
      781 cctcgctgca gtggaacaag gacggcaccc agctggccac cgcctcgatt ggcgatcgat
      841 ccatcatcgt ctggcagccg gacaacggaa tgatgcagcc gctgaagcgc ctgggtccgc
      901 cgggctcgct gctcaagtgg tcgccggaca acgactggct gttcgcggcc accgttgacc
      961 gggtgttccg cgtgtggaac tgccaccagc agtggacgac ggagcgctgg gtgtgcggac
     1021 ccggtggcca tgtgcagaca gcctgctggt cgccctgcgg tcgcttcctg ctcttcgtca
     1081 gcagcgccga accgattctc tatcgcctgc agttcgtgca gcagagtctg ctctcgtctt
     1141 cggcggatga gaaggaaatt ctgcccatcg cggatttaaa cgcctgcagc atcgatgcga
     1201 atcgcacgct catcggcggt cccgcccagc agctggcttg ggatccgcat gggaactacc
     1261 tcgtggtcac cttcaagtcg accaactgca tcgccgtttt ccgcaccttc gtccagaagt
     1321 tcgatctgca gatctcggcg gcgtattatc tgagcggaga gacggcaacg gagcatccca
     1381 gcttcatctg cttccagccg ctgtacaagg acaacgatcg atccgttctg acgatcgcct
     1441 ggtcgtcggg tcgtattcag tactacgcct tcgactgatg ttgttttcat tgtaatattt
     1501 tatttgattt ggttttcgta agcgttaata cacagttaaa caggataa