Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii TweedleZ (TwdlZ), mRNA.


LOCUS       XM_017150627            1034 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017150627
VERSION     XM_017150627.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017150627.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1034
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1034
                     /gene="TwdlZ"
                     /note="TweedleZ; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 1 Protein"
                     /db_xref="GeneID:108063510"
     CDS             224..874
                     /gene="TwdlZ"
                     /codon_start=1
                     /product="uncharacterized protein TwdlZ"
                     /protein_id="XP_017006116.2"
                     /db_xref="GeneID:108063510"
                     /translation="MLNSFVVVWLSLSSLAALSWAQGPRSYLPPSAANSQMEPIITKQ
                     FFSISPAEDPEDLEPKTRHLFIGQPRRNYRVIFIRAPAGNSEHVKYTAELAPQEERTV
                     IYVLTRKQHELEAKDIEVPGEKPQTEQKPDVFFIKYKTNDEAAAAQKEIQTQYDQLGG
                     NTEILAPYVGPLKSVIGALDGGGPQYSAPYQVPQSNGYHYDRPTTSTILAPVERSY"
     misc_feature    344..637
                     /gene="TwdlZ"
                     /note="Domain of unknown function (DUF243); Region:
                     DUF243; pfam03103"
                     /db_xref="CDD:460806"
ORIGIN      
        1 cttaccacat agcaattttt acattttacg cacaattaat ttttcgaccc aacgcaagtt
       61 cgttgcccaa gtcttttgtt ttggcagcag ttttaatgca tgtgaaatgg ctaattttaa
      121 cagattttct ctgtccaatc tggctgtgcg atctaactag agctgtctta aaagtgaagc
      181 tgcgttggaa aaacctcatc agttgtcttc tgaaattcgc gaaatgttga actcattcgt
      241 ggtggtgtgg ctttcacttt cctcgttggc agctctttcc tgggctcaag gaccgcgttc
      301 ctatctgcca ccatcagcag ctaattcgca aatggaaccc attataacga agcagttctt
      361 tagcatttca ccagccgaag atcccgagga tctggagcca aagacaaggc atttgtttat
      421 tggccaaccg cgccgcaatt accgagttat ctttattcga gctccggcgg gaaacagtga
      481 gcatgtgaag tacacggcgg agttggcgcc ccaggaggag cgaaccgtga tctatgttct
      541 cacgcggaag cagcacgaac tggaggccaa ggacattgag gtgccggggg agaaacccca
      601 aacggaacaa aaaccggacg tattcttcat caagtacaaa acgaacgatg aggcggcggc
      661 tgcccaaaag gagatccaaa cgcagtacga tcaacttggt ggaaataccg aaattttggc
      721 gccctatgtg gggcccctta agtcggtgat tggcgccctc gatggcggtg gtcctcaata
      781 ttcagctccc taccaagttc cacaatccaa tggctatcac tacgatagac ccaccacctc
      841 cacaattttg gcgccagtgg aacgatccta ctgaagcgcc gtttatatcc gcaactcgtt
      901 gaatattcca cgctatttgc atttaattga taagccattt ccactagcga atttatcaaa
      961 aaaaaaaaaa actggcgaac gcgtaaataa aaatggtttc ttttaattat ttcttctttt
     1021 ttatcttctt ctgt