Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017150627 1034 bp mRNA linear INV 09-DEC-2024 ACCESSION XM_017150627 VERSION XM_017150627.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017150627.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1034 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1034 /gene="TwdlZ" /note="TweedleZ; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108063510" CDS 224..874 /gene="TwdlZ" /codon_start=1 /product="uncharacterized protein TwdlZ" /protein_id="XP_017006116.2" /db_xref="GeneID:108063510" /translation="MLNSFVVVWLSLSSLAALSWAQGPRSYLPPSAANSQMEPIITKQ FFSISPAEDPEDLEPKTRHLFIGQPRRNYRVIFIRAPAGNSEHVKYTAELAPQEERTV IYVLTRKQHELEAKDIEVPGEKPQTEQKPDVFFIKYKTNDEAAAAQKEIQTQYDQLGG NTEILAPYVGPLKSVIGALDGGGPQYSAPYQVPQSNGYHYDRPTTSTILAPVERSY" misc_feature 344..637 /gene="TwdlZ" /note="Domain of unknown function (DUF243); Region: DUF243; pfam03103" /db_xref="CDD:460806" ORIGIN 1 cttaccacat agcaattttt acattttacg cacaattaat ttttcgaccc aacgcaagtt 61 cgttgcccaa gtcttttgtt ttggcagcag ttttaatgca tgtgaaatgg ctaattttaa 121 cagattttct ctgtccaatc tggctgtgcg atctaactag agctgtctta aaagtgaagc 181 tgcgttggaa aaacctcatc agttgtcttc tgaaattcgc gaaatgttga actcattcgt 241 ggtggtgtgg ctttcacttt cctcgttggc agctctttcc tgggctcaag gaccgcgttc 301 ctatctgcca ccatcagcag ctaattcgca aatggaaccc attataacga agcagttctt 361 tagcatttca ccagccgaag atcccgagga tctggagcca aagacaaggc atttgtttat 421 tggccaaccg cgccgcaatt accgagttat ctttattcga gctccggcgg gaaacagtga 481 gcatgtgaag tacacggcgg agttggcgcc ccaggaggag cgaaccgtga tctatgttct 541 cacgcggaag cagcacgaac tggaggccaa ggacattgag gtgccggggg agaaacccca 601 aacggaacaa aaaccggacg tattcttcat caagtacaaa acgaacgatg aggcggcggc 661 tgcccaaaag gagatccaaa cgcagtacga tcaacttggt ggaaataccg aaattttggc 721 gccctatgtg gggcccctta agtcggtgat tggcgccctc gatggcggtg gtcctcaata 781 ttcagctccc taccaagttc cacaatccaa tggctatcac tacgatagac ccaccacctc 841 cacaattttg gcgccagtgg aacgatccta ctgaagcgcc gtttatatcc gcaactcgtt 901 gaatattcca cgctatttgc atttaattga taagccattt ccactagcga atttatcaaa 961 aaaaaaaaaa actggcgaac gcgtaaataa aaatggtttc ttttaattat ttcttctttt 1021 ttatcttctt ctgt