Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017150616 443 bp mRNA linear INV 09-DEC-2024 (LOC108063502), mRNA. ACCESSION XM_017150616 VERSION XM_017150616.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017150616.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..443 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..443 /gene="LOC108063502" /note="sarcocystatin-A-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108063502" CDS 30..407 /gene="LOC108063502" /codon_start=1 /product="sarcocystatin-A-like" /protein_id="XP_017006105.2" /db_xref="GeneID:108063502" /translation="MFVAKILILCSACLLVSGTPQGFGGFGAPKTLEGEELVESQRTL QASLTKLAAGEGPHYRISRIISATTQVVAGSKDEYNVELIDREGVIKVCNVDIWSRSW LPNGIQVTFRCPNEPELVRTHNA" misc_feature <201..368 /gene="LOC108063502" /note="Cystatin-like domain; Cystatins are a family of cysteine protease inhibitors that occur mainly as single domain proteins. However some extracellular proteins such as kininogen, His-rich glycoprotein and fetuin also contain these domains; Region: CY; cd00042" /db_xref="CDD:238002" misc_feature order(237..245,249..251) /gene="LOC108063502" /note="putative proteinase inhibition site [active]" /db_xref="CDD:238002" ORIGIN 1 cgtaaagcaa gcagaaaaaa ccattcgaaa tgttcgtcgc caagatcctg attttgtgca 61 gtgcctgttt gttggtcagt ggcactcccc agggattcgg aggattcgga gccccaaaga 121 ccctggaggg cgaggaactg gtcgaatccc agcgaacatt gcaggcatcg ctcaccaaac 181 tggccgccgg cgaaggaccc cactatcgca tctccaggat catttcggca accactcagg 241 tggtcgctgg atccaaggac gagtacaacg tggagctgat cgatagggaa ggtgtcatta 301 aggtgtgcaa tgtggacatt tggtcgcgct cctggctccc caacggcatt caggtgacct 361 tcaggtgccc caacgaaccg gaactggtta ggacccacaa tgcctaagga aatatcatgg 421 aaatttgatt attacacaaa gaa