Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii sarcocystatin-A-like


LOCUS       XM_017150616             443 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108063502), mRNA.
ACCESSION   XM_017150616
VERSION     XM_017150616.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017150616.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..443
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..443
                     /gene="LOC108063502"
                     /note="sarcocystatin-A-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:108063502"
     CDS             30..407
                     /gene="LOC108063502"
                     /codon_start=1
                     /product="sarcocystatin-A-like"
                     /protein_id="XP_017006105.2"
                     /db_xref="GeneID:108063502"
                     /translation="MFVAKILILCSACLLVSGTPQGFGGFGAPKTLEGEELVESQRTL
                     QASLTKLAAGEGPHYRISRIISATTQVVAGSKDEYNVELIDREGVIKVCNVDIWSRSW
                     LPNGIQVTFRCPNEPELVRTHNA"
     misc_feature    <201..368
                     /gene="LOC108063502"
                     /note="Cystatin-like domain; Cystatins are a family of
                     cysteine protease inhibitors that occur mainly as single
                     domain proteins. However some extracellular proteins such
                     as kininogen, His-rich glycoprotein and fetuin also
                     contain these domains; Region: CY; cd00042"
                     /db_xref="CDD:238002"
     misc_feature    order(237..245,249..251)
                     /gene="LOC108063502"
                     /note="putative proteinase inhibition site [active]"
                     /db_xref="CDD:238002"
ORIGIN      
        1 cgtaaagcaa gcagaaaaaa ccattcgaaa tgttcgtcgc caagatcctg attttgtgca
       61 gtgcctgttt gttggtcagt ggcactcccc agggattcgg aggattcgga gccccaaaga
      121 ccctggaggg cgaggaactg gtcgaatccc agcgaacatt gcaggcatcg ctcaccaaac
      181 tggccgccgg cgaaggaccc cactatcgca tctccaggat catttcggca accactcagg
      241 tggtcgctgg atccaaggac gagtacaacg tggagctgat cgatagggaa ggtgtcatta
      301 aggtgtgcaa tgtggacatt tggtcgcgct cctggctccc caacggcatt caggtgacct
      361 tcaggtgccc caacgaaccg gaactggtta ggacccacaa tgcctaagga aatatcatgg
      421 aaatttgatt attacacaaa gaa