Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017150614 971 bp mRNA linear INV 09-DEC-2024 CWC15 (c12.1), mRNA. ACCESSION XM_017150614 VERSION XM_017150614.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017150614.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..971 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..971 /gene="c12.1" /note="spliceosome-associated protein CWC15; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108063500" CDS 96..857 /gene="c12.1" /codon_start=1 /product="protein CWC15 homolog" /protein_id="XP_017006103.2" /db_xref="GeneID:108063500" /translation="MTTAARPTFDPARGGSGRGEKDLSALSKQYSSRDLPGHTKLKYR ETGQGTSEEIRGRDFRKELEEREREARSGPGATSSSGKALPSIVRKAIEANSAPAGKR AKPDALQQQQQLQQQQAANLDADEPLDNDSSDSDSDSDDDDAALLAELQKIKQERLQE TARRESEKKQEDERIRMENILSGNPLINYEPGTAASAAGRASGLGGDLKIKRRWDDDV VFKNCARSAPEKKTHFVNDALRSDFHKKFMDKYIK" misc_feature 96..851 /gene="c12.1" /note="Cwf15/Cwc15 cell cycle control protein; Region: Cwf_Cwc_15; pfam04889" /db_xref="CDD:428176" polyA_site 971 /gene="c12.1" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 acagccacac tggcggaata aagcaataaa cgcaattaga agcatttcgt tttaactgaa 61 tttaaccatt ttaaacgata attagctagc ccaaaatgac cacagccgcg cgtccgacct 121 ttgaccccgc ccgcggcggc tccggccgcg gcgaaaagga cctgagtgcg ctgagcaagc 181 agtattccag tcgcgatctg ccaggccaca cgaagctgaa atacagggag acgggccagg 241 gcaccagcga ggagatccgc ggccgggact tccgcaagga gctggaggag cgcgagcgcg 301 aggcccgttc cggtccggga gccacttcct cctcgggcaa ggcgctgccc tccattgtgc 361 gcaaggccat cgaggccaac agtgcgcccg ctggcaagag agccaaaccc gacgccctgc 421 agcagcagca gcagctgcag caacagcagg ccgccaatct ggacgccgac gagccgctgg 481 acaacgatag ctccgattcg gacagcgatt cggatgacga cgatgccgcc ctgctggccg 541 agctgcagaa gatcaagcag gagcgcctcc aggagacggc gcgtcgcgag tcggagaaga 601 agcaggagga cgagcgcatc cgcatggaga acatcttgtc gggcaatccg ctgattaact 661 acgaaccagg aaccgctgcc tccgccgcgg gacgtgcctc tggcctcggt ggcgatctga 721 agatcaagcg ccgctgggac gacgacgtcg tgttcaagaa ctgcgcccgc tcggcgcccg 781 agaagaagac gcacttcgtc aacgacgccc tgcgctccga tttccacaag aagttcatgg 841 acaagtacat caaataggcg ccctaagttc gctctaagtc tcaaccgctt tttgtaatag 901 tctaagtaac ccaattgtca actttttttc ggccttccgc cgctattaaa attcgcattt 961 tgtaagaaga a