Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii spliceosome-associated protein


LOCUS       XM_017150614             971 bp    mRNA    linear   INV 09-DEC-2024
            CWC15 (c12.1), mRNA.
ACCESSION   XM_017150614
VERSION     XM_017150614.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017150614.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..971
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..971
                     /gene="c12.1"
                     /note="spliceosome-associated protein CWC15; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:108063500"
     CDS             96..857
                     /gene="c12.1"
                     /codon_start=1
                     /product="protein CWC15 homolog"
                     /protein_id="XP_017006103.2"
                     /db_xref="GeneID:108063500"
                     /translation="MTTAARPTFDPARGGSGRGEKDLSALSKQYSSRDLPGHTKLKYR
                     ETGQGTSEEIRGRDFRKELEEREREARSGPGATSSSGKALPSIVRKAIEANSAPAGKR
                     AKPDALQQQQQLQQQQAANLDADEPLDNDSSDSDSDSDDDDAALLAELQKIKQERLQE
                     TARRESEKKQEDERIRMENILSGNPLINYEPGTAASAAGRASGLGGDLKIKRRWDDDV
                     VFKNCARSAPEKKTHFVNDALRSDFHKKFMDKYIK"
     misc_feature    96..851
                     /gene="c12.1"
                     /note="Cwf15/Cwc15 cell cycle control protein; Region:
                     Cwf_Cwc_15; pfam04889"
                     /db_xref="CDD:428176"
     polyA_site      971
                     /gene="c12.1"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 acagccacac tggcggaata aagcaataaa cgcaattaga agcatttcgt tttaactgaa
       61 tttaaccatt ttaaacgata attagctagc ccaaaatgac cacagccgcg cgtccgacct
      121 ttgaccccgc ccgcggcggc tccggccgcg gcgaaaagga cctgagtgcg ctgagcaagc
      181 agtattccag tcgcgatctg ccaggccaca cgaagctgaa atacagggag acgggccagg
      241 gcaccagcga ggagatccgc ggccgggact tccgcaagga gctggaggag cgcgagcgcg
      301 aggcccgttc cggtccggga gccacttcct cctcgggcaa ggcgctgccc tccattgtgc
      361 gcaaggccat cgaggccaac agtgcgcccg ctggcaagag agccaaaccc gacgccctgc
      421 agcagcagca gcagctgcag caacagcagg ccgccaatct ggacgccgac gagccgctgg
      481 acaacgatag ctccgattcg gacagcgatt cggatgacga cgatgccgcc ctgctggccg
      541 agctgcagaa gatcaagcag gagcgcctcc aggagacggc gcgtcgcgag tcggagaaga
      601 agcaggagga cgagcgcatc cgcatggaga acatcttgtc gggcaatccg ctgattaact
      661 acgaaccagg aaccgctgcc tccgccgcgg gacgtgcctc tggcctcggt ggcgatctga
      721 agatcaagcg ccgctgggac gacgacgtcg tgttcaagaa ctgcgcccgc tcggcgcccg
      781 agaagaagac gcacttcgtc aacgacgccc tgcgctccga tttccacaag aagttcatgg
      841 acaagtacat caaataggcg ccctaagttc gctctaagtc tcaaccgctt tttgtaatag
      901 tctaagtaac ccaattgtca actttttttc ggccttccgc cgctattaaa attcgcattt
      961 tgtaagaaga a