Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii sarcocystatin-A-like


LOCUS       XM_017150613             703 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108063499), mRNA.
ACCESSION   XM_017150613
VERSION     XM_017150613.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017150613.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..703
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..703
                     /gene="LOC108063499"
                     /note="sarcocystatin-A-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:108063499"
     CDS             247..624
                     /gene="LOC108063499"
                     /codon_start=1
                     /product="sarcocystatin-A-like"
                     /protein_id="XP_017006102.2"
                     /db_xref="GeneID:108063499"
                     /translation="MFLAKILILFTACFLVSANGHSFGAVGAPRTLEGEDLASAQRTL
                     EASLTKLAAGEGPHYRISKILSATSQVVAGSKHVYSVELIDNEGATKVCNVDIWSRSW
                     EPNGIQVTFRCPNEPELVRKHNA"
     misc_feature    325..585
                     /gene="LOC108063499"
                     /note="Cystatin-like domain; Cystatins are a family of
                     cysteine protease inhibitors that occur mainly as single
                     domain proteins. However some extracellular proteins such
                     as kininogen, His-rich glycoprotein and fetuin also
                     contain these domains; Region: CY; cd00042"
                     /db_xref="CDD:238002"
     misc_feature    order(325..327,454..462,466..468)
                     /gene="LOC108063499"
                     /note="putative proteinase inhibition site [active]"
                     /db_xref="CDD:238002"
ORIGIN      
        1 atgaaacgca ctttgtggcc ttggcgttgg aattagtcgg tcagtgaaac cgaaagcctt
       61 atcgctcgaa aaggaggcaa tcgtgaccca accgatgcga taatcccctg agaaatatat
      121 atgtatgtgc actaattaat ggaccgctcc gatggcgatt aatctatgga ctctgctata
      181 aaaacctagc tggcagcaat cgatccatca gtttgtttat ttcgttgcaa tcgaaacaac
      241 agcaaaatgt ttctcgccaa gatcctaatc ctcttcaccg cctgttttct ggtcagtgca
      301 aatggccatt cattcggagc agttggggct ccaagaactc ttgagggcga ggatttggcc
      361 agtgctcaac ggactcttga ggcatctctc accaaactgg ccgctggcga aggaccccac
      421 tatcgcatct ccaagatcct gtctgccacc tctcaggtgg tcgctggctc caagcacgtc
      481 tactccgtgg agctaatcga caacgaaggt gccaccaagg tgtgcaatgt ggacatctgg
      541 agccgcagct gggagccaaa cggcatccag gtgaccttcc ggtgtcccaa cgaaccggaa
      601 ctggttagga aacacaatgc ctaggtggat ataagtgctt cttgtgtgtc gaaatggaag
      661 aaatgtgccc ccttcgttaa ctgattcttt gaataaaatt ata