Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017150613 703 bp mRNA linear INV 09-DEC-2024 (LOC108063499), mRNA. ACCESSION XM_017150613 VERSION XM_017150613.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017150613.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..703 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..703 /gene="LOC108063499" /note="sarcocystatin-A-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108063499" CDS 247..624 /gene="LOC108063499" /codon_start=1 /product="sarcocystatin-A-like" /protein_id="XP_017006102.2" /db_xref="GeneID:108063499" /translation="MFLAKILILFTACFLVSANGHSFGAVGAPRTLEGEDLASAQRTL EASLTKLAAGEGPHYRISKILSATSQVVAGSKHVYSVELIDNEGATKVCNVDIWSRSW EPNGIQVTFRCPNEPELVRKHNA" misc_feature 325..585 /gene="LOC108063499" /note="Cystatin-like domain; Cystatins are a family of cysteine protease inhibitors that occur mainly as single domain proteins. However some extracellular proteins such as kininogen, His-rich glycoprotein and fetuin also contain these domains; Region: CY; cd00042" /db_xref="CDD:238002" misc_feature order(325..327,454..462,466..468) /gene="LOC108063499" /note="putative proteinase inhibition site [active]" /db_xref="CDD:238002" ORIGIN 1 atgaaacgca ctttgtggcc ttggcgttgg aattagtcgg tcagtgaaac cgaaagcctt 61 atcgctcgaa aaggaggcaa tcgtgaccca accgatgcga taatcccctg agaaatatat 121 atgtatgtgc actaattaat ggaccgctcc gatggcgatt aatctatgga ctctgctata 181 aaaacctagc tggcagcaat cgatccatca gtttgtttat ttcgttgcaa tcgaaacaac 241 agcaaaatgt ttctcgccaa gatcctaatc ctcttcaccg cctgttttct ggtcagtgca 301 aatggccatt cattcggagc agttggggct ccaagaactc ttgagggcga ggatttggcc 361 agtgctcaac ggactcttga ggcatctctc accaaactgg ccgctggcga aggaccccac 421 tatcgcatct ccaagatcct gtctgccacc tctcaggtgg tcgctggctc caagcacgtc 481 tactccgtgg agctaatcga caacgaaggt gccaccaagg tgtgcaatgt ggacatctgg 541 agccgcagct gggagccaaa cggcatccag gtgaccttcc ggtgtcccaa cgaaccggaa 601 ctggttagga aacacaatgc ctaggtggat ataagtgctt cttgtgtgtc gaaatggaag 661 aaatgtgccc ccttcgttaa ctgattcttt gaataaaatt ata