Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017150282 578 bp mRNA linear INV 09-DEC-2024 (LOC108063242), mRNA. ACCESSION XM_017150282 VERSION XM_017150282.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017150282.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..578 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..578 /gene="LOC108063242" /note="uncharacterized LOC108063242; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108063242" CDS 143..466 /gene="LOC108063242" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_017005771.1" /db_xref="GeneID:108063242" /translation="MASITFKNRPTQVLHTYQVWRIGSNVNDKSLDYCLADKSVDKFH ASLTRGEKGLFLVNESRHGSVAVNGERVGGPVLITYRDAINGIVKLRFGRVEGYLRVS GSITG" misc_feature 149..445 /gene="LOC108063242" /note="Mutator 2 Fork head associated domain; Region: MU2_FHA; pfam18221" /db_xref="CDD:375648" polyA_site 578 /gene="LOC108063242" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gccatgctga actacagaaa cacatagaat cctttcaaga tagcaaaaaa aatcagaata 61 ttgatattaa tcaaataaaa tcagagaaaa gtagagctaa aaatcgaaat aaacaattgg 121 gatttcgtat agtcggtata gaatggctag tattacgttc aagaatcgac ccacccaggt 181 gctgcacacc taccaagtct ggcgcatcgg cagcaatgtg aacgacaaga gtctggacta 241 ctgtcttgcg gacaagtcgg tggacaagtt ccatgccagc ttgacccgcg gcgagaaggg 301 tttgtttctg gtcaacgaga gtcgccatgg aagtgtggcc gtgaatggcg agcgggttgg 361 cggtcccgtg ctgatcacct atcgcgatgc catcaatggc attgtcaagc tccgttttgg 421 ccgggtcgag ggatatctgc gcgtatcggg aagcattact ggctaaccca gcatcctagt 481 ctctctttgg atatatgggt tttttaaatc gttcgttttt ttgtacctaa acgtgcattt 541 tcataaatac aaaaaaaaga taaattgata aaatgcaa