PREDICTED: Drosophila takahashii microfibril-associated

LOCUS       XM_017150249            1122 bp    mRNA    linear   INV 09-DEC-2024
            glycoprotein 4-like (LOC108063216), mRNA.
ACCESSION   XM_017150249
VERSION     XM_017150249.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017150249.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1122
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1122
                     /gene="LOC108063216"
                     /note="microfibril-associated glycoprotein 4-like; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon."
                     /db_xref="GeneID:108063216"
     CDS             15..1031
                     /gene="LOC108063216"
                     /codon_start=1
                     /product="microfibril-associated glycoprotein 4-like"
                     /protein_id="XP_017005738.2"
                     /db_xref="GeneID:108063216"
                     /translation="MKSGLVVIVLFLFLLKEHPLAGANSIKDVSKESIYESAENKSNS
                     YCFSIFKPILDYFVKNADEAKAELRKTIEDLQSQLKNAKDRIEVKDILMSVKDENISD
                     LRNHIKSLETTLSERSKQLSECRESDFPDTCPSGGANEVYQIKPRGMEPFKVPCVSSA
                     AGWTVIQRRFDGSENFDRNWTDYRQGFGNIRGEFFIGLEKLHRMTVARPHELYIKLGK
                     VDGSTSYARYDDFQIGSEAESYELKKTGKYSGEAGDSIAMHLGNKFSTFDRDNDRDTR
                     HCAGNKCGGWWYNDCAQSSLNGQYYKNGQSDEKNGINWASWHDYTYTISLTFAEMMIR
                     PKSL"
     misc_feature    <210..>383
                     /gene="LOC108063216"
                     /note="Autophagy protein 16 (ATG16); Region: ATG16;
                     pfam08614"
                     /db_xref="CDD:462536"
     misc_feature    435..1022
                     /gene="LOC108063216"
                     /note="Fibrinogen-related domains (FReDs); C terminal
                     globular domain of fibrinogen. Fibrinogen is involved in
                     blood clotting, being activated by thrombin to assemble
                     into fibrin clots. The N-termini of 2 times 3 chains come
                     together to form a globular...; Region: FReD; cd00087"
                     /db_xref="CDD:238040"
     misc_feature    735..737
                     /gene="LOC108063216"
                     /note="gamma-gamma dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238040"
     misc_feature    order(822..824,828..830,834..836)
                     /gene="LOC108063216"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238040"
     misc_feature    order(846..848,855..860,885..890)
                     /gene="LOC108063216"
                     /note="polymerization pocket [active]"
                     /db_xref="CDD:238040"
ORIGIN      
        1 tgctctcgtt cgcaatgaaa tccgggcttg tagtgattgt tcttttcctt ttccttctga
       61 aagaacatcc tttagctggt gcaaactcaa tcaaggatgt atcaaaggaa tccatttatg
      121 agagtgctga aaacaaatcc aacagttatt gtttttcgat ctttaagcct attcttgatt
      181 atttcgtgaa aaatgccgac gaagccaaag ctgaattgag aaagaccatt gaggacttac
      241 agagtcagtt gaaaaatgcg aaggatcgaa tcgaagtaaa agatatactt atgagtgtga
      301 aagatgaaaa catctcggac ctacggaacc acattaaatc gcttgagaca acgctatcgg
      361 aaagatccaa acagctttcg gagtgccgtg agtctgattt tccggacaca tgtcccagtg
      421 gcggagcgaa tgaggtttac caaataaaac ctcggggaat ggagccattt aaggtgccct
      481 gtgtgtcctc tgcagccggt tggacggtaa tccagagacg tttcgacgga tccgagaact
      541 tcgacaggaa ctggacagat tatagacaag gatttggaaa tatcagggga gaatttttca
      601 ttggcctgga gaaactacat cgaatgaccg tcgctcgacc ccacgaactc tacattaagc
      661 tgggcaaggt ggacggatcc accagttacg ctcgctatga tgactttcaa attggcagtg
      721 aagcagagtc gtatgagctg aagaagacgg ggaagtactc cggagaagcc ggtgactcca
      781 ttgcaatgca tcttggtaat aagttttcca catttgatcg ggataatgac agggatacca
      841 gacattgcgc cggtaacaaa tgcggtggtt ggtggtacaa tgactgtgct caaagttcgc
      901 tcaatggaca gtactataaa aatggccaaa gtgacgaaaa aaatggaatt aattgggctt
      961 catggcatga ctatacctat acgatctcgc taacctttgc cgaaatgatg ataaggccca
     1021 aatccctgtg agccgcatat tttgcttaat gctgcacaaa cgtataaaaa attttaattt
     1081 taatacaaga atgattaatt tctaaatata cttacgattc ga