Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017150237            1296 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108063207), mRNA.
ACCESSION   XM_017150237
VERSION     XM_017150237.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017150237.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1296
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1296
                     /gene="LOC108063207"
                     /note="uncharacterized LOC108063207; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:108063207"
     CDS             163..660
                     /gene="LOC108063207"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_017005726.2"
                     /db_xref="GeneID:108063207"
                     /translation="MVFYLEHVLTGDQVFLLEGVNTLGRHSTCSWIMKYDYMSRFHAI
                     ILVKRGQIFIKELEALNGVFLNYSEERIGLGLREISVGDDLSFGVKVNGDEELEIPTS
                     FGIFTVKSKEPDSTDPMDEKPILDERTEPDSTDPLGEDPKLDYPTTEMEGQETNDIEE
                     PEKLH"
     misc_feature    190..426
                     /gene="LOC108063207"
                     /note="forkhead associated (FHA) domain superfamily;
                     Region: FHA; cd00060"
                     /db_xref="CDD:438714"
     misc_feature    226..>639
                     /gene="LOC108063207"
                     /note="Predicted component of the type VI protein
                     secretion system, contains a FHA domain [Signal
                     transduction mechanisms, Intracellular trafficking,
                     secretion, and vesicular transport]; Region: COG3456"
                     /db_xref="CDD:442679"
     misc_feature    order(232..237,277..282,286..288,343..348)
                     /gene="LOC108063207"
                     /note="phosphopeptide binding site [polypeptide binding];
                     other site"
                     /db_xref="CDD:438714"
ORIGIN      
        1 gtcttaataa aaaagataac tatgtgagaa gttggttttt cagaaactaa tgaaacggtt
       61 gatagtaatt aggattaaag tagaatttga gttatcgact acaatcgatt gattggccat
      121 ccctgtttta agctaaccga atcgttggaa atttcgtgga aaatggtgtt ctacttggag
      181 cacgtgctca cgggcgatca ggttttcctg ctcgagggcg taaacactct gggacgccac
      241 tccacctgca gctggataat gaagtacgac tatatgtccc gattccacgc catcatcctg
      301 gtgaagcgcg gtcagatttt catcaaggag ctggaagccc tcaatggcgt gttcctgaac
      361 tattcggagg agcgaatagg attgggattg cgggagatat ccgtgggcga cgacctgtcc
      421 ttcggggtca aggtgaacgg cgacgaggag ctcgaaatac cgacctcttt cggtatcttt
      481 accgttaagt cgaaggagcc ggactccacc gatcccatgg acgaaaagcc gatcctggat
      541 gaacgtacgg agccggactc caccgatcct ctgggggaag accccaaact ggattatccc
      601 acaactgaaa tggaaggcca agaaactaac gacatcgaag agccagaaaa attacactaa
      661 tccgcggaaa cacaaatgca aatgccgcac ttaaggcgtt aatttctcca gcccgataag
      721 accaactaaa actggaggcc ttgcattcaa atggactgca aggagctcat gcaattccac
      781 aaaaactctt cacagttgcg gctgacataa taggtttagt taagaaaata attattagca
      841 aatgtttact ataattttcg ctctattcaa actttaattt tttttttaga ttttatgtag
      901 tttttctatt tcaactttaa tttgttttta agattttctc acttatatat tgacttttca
      961 atacgtaatt attttcttgg tattgttatt ttttgaattg attcacttaa acaaattcaa
     1021 ttaacttgta ttaaatagtg taacaaaaaa ctacaaatgt acatgtatgt gcatatatac
     1081 tctatatcta ttttttttgc ggctgacaaa ataggtttag ttaagaaaat aattattagc
     1141 aaaagtatcc tataatgttg gctctattca aactttaatt tattttttag attttctgct
     1201 atgtttactt ttcaatatgt attttttcta ttccaactta atttttttaa gtttttcttc
     1261 tttttataat tactctccaa aatttagatt atctat