Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017150237 1296 bp mRNA linear INV 09-DEC-2024 (LOC108063207), mRNA. ACCESSION XM_017150237 VERSION XM_017150237.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017150237.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1296 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1296 /gene="LOC108063207" /note="uncharacterized LOC108063207; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108063207" CDS 163..660 /gene="LOC108063207" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_017005726.2" /db_xref="GeneID:108063207" /translation="MVFYLEHVLTGDQVFLLEGVNTLGRHSTCSWIMKYDYMSRFHAI ILVKRGQIFIKELEALNGVFLNYSEERIGLGLREISVGDDLSFGVKVNGDEELEIPTS FGIFTVKSKEPDSTDPMDEKPILDERTEPDSTDPLGEDPKLDYPTTEMEGQETNDIEE PEKLH" misc_feature 190..426 /gene="LOC108063207" /note="forkhead associated (FHA) domain superfamily; Region: FHA; cd00060" /db_xref="CDD:438714" misc_feature 226..>639 /gene="LOC108063207" /note="Predicted component of the type VI protein secretion system, contains a FHA domain [Signal transduction mechanisms, Intracellular trafficking, secretion, and vesicular transport]; Region: COG3456" /db_xref="CDD:442679" misc_feature order(232..237,277..282,286..288,343..348) /gene="LOC108063207" /note="phosphopeptide binding site [polypeptide binding]; other site" /db_xref="CDD:438714" ORIGIN 1 gtcttaataa aaaagataac tatgtgagaa gttggttttt cagaaactaa tgaaacggtt 61 gatagtaatt aggattaaag tagaatttga gttatcgact acaatcgatt gattggccat 121 ccctgtttta agctaaccga atcgttggaa atttcgtgga aaatggtgtt ctacttggag 181 cacgtgctca cgggcgatca ggttttcctg ctcgagggcg taaacactct gggacgccac 241 tccacctgca gctggataat gaagtacgac tatatgtccc gattccacgc catcatcctg 301 gtgaagcgcg gtcagatttt catcaaggag ctggaagccc tcaatggcgt gttcctgaac 361 tattcggagg agcgaatagg attgggattg cgggagatat ccgtgggcga cgacctgtcc 421 ttcggggtca aggtgaacgg cgacgaggag ctcgaaatac cgacctcttt cggtatcttt 481 accgttaagt cgaaggagcc ggactccacc gatcccatgg acgaaaagcc gatcctggat 541 gaacgtacgg agccggactc caccgatcct ctgggggaag accccaaact ggattatccc 601 acaactgaaa tggaaggcca agaaactaac gacatcgaag agccagaaaa attacactaa 661 tccgcggaaa cacaaatgca aatgccgcac ttaaggcgtt aatttctcca gcccgataag 721 accaactaaa actggaggcc ttgcattcaa atggactgca aggagctcat gcaattccac 781 aaaaactctt cacagttgcg gctgacataa taggtttagt taagaaaata attattagca 841 aatgtttact ataattttcg ctctattcaa actttaattt tttttttaga ttttatgtag 901 tttttctatt tcaactttaa tttgttttta agattttctc acttatatat tgacttttca 961 atacgtaatt attttcttgg tattgttatt ttttgaattg attcacttaa acaaattcaa 1021 ttaacttgta ttaaatagtg taacaaaaaa ctacaaatgt acatgtatgt gcatatatac 1081 tctatatcta ttttttttgc ggctgacaaa ataggtttag ttaagaaaat aattattagc 1141 aaaagtatcc tataatgttg gctctattca aactttaatt tattttttag attttctgct 1201 atgtttactt ttcaatatgt attttttcta ttccaactta atttttttaa gtttttcttc 1261 tttttataat tactctccaa aatttagatt atctat