PREDICTED: Drosophila takahashii ADP-ribosylation factor-like

LOCUS       XM_017150211             819 bp    mRNA    linear   INV 09-DEC-2024
            protein 3 (LOC108063194), mRNA.
ACCESSION   XM_017150211
VERSION     XM_017150211.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 18, 2021 this sequence version replaced XM_017150211.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 2% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..819
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..819
                     /gene="LOC108063194"
                     /note="ADP-ribosylation factor-like protein 3; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:108063194"
     CDS             1..819
                     /gene="LOC108063194"
                     /codon_start=1
                     /product="ADP-ribosylation factor-like protein 3"
                     /protein_id="XP_017005700.2"
                     /db_xref="GeneID:108063194"
                     /translation="MGLLCAKLRDCCCCVRSMEEFQVLLLGPSGSGKTELGHRLSRSP
                     RASDDQEATNGVRCYQISGGFQDISELPAKLQLTEVGGNAEMQRLWRHYYASSHALIY
                     CFDLGSDPEGLEATFALLTQCLRGTQLAGKPVLLVASRHRDGVQLYDVEYAFGLEELA
                     RSCGCPLLICHMDSADDLQRGVRWLCHQLLARKSQLDQRIRYDVNMQVWQRRKRSLLS
                     SGKLAQVHRQRFRRHSRRILPAIQGFGGMTMRPSTAPANIFFVNCREQEENHNF"
     misc_feature    64..564
                     /gene="LOC108063194"
                     /note="Members of the P-loop NTPase domain superfamily are
                     characterized by a conserved nucleotide phosphate-binding
                     motif, also referred to as the Walker A motif
                     (GxxxxGK[S/T], where x is any residue), and the Walker B
                     motif (hhhh[D/E], where h is a...; Region: P-loop
                     containing Nucleoside Triphosphate Hydrolases; cl38936"
                     /db_xref="CDD:476819"
     misc_feature    79..102
                     /gene="LOC108063194"
                     /note="G1 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    order(85..105,244..246,415..420,445..447,520..525)
                     /gene="LOC108063194"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206648"
     misc_feature    184..186
                     /gene="LOC108063194"
                     /note="G2 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    order(196..198,202..207)
                     /gene="LOC108063194"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206648"
     misc_feature    235..246
                     /gene="LOC108063194"
                     /note="G3 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    order(241..246,292..297)
                     /gene="LOC108063194"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206648"
     misc_feature    order(415..423,445..447)
                     /gene="LOC108063194"
                     /note="G4 box; other site"
                     /db_xref="CDD:206648"
ORIGIN      
        1 atgggtttac tgtgcgccaa gctgcgcgac tgctgttgtt gtgttcgatc gatggaggaa
       61 ttccaggtgc tgctcctcgg accctcgggc agtggcaaaa cggagctggg acaccgcttg
      121 agcagatctc cacgagcttc ggatgaccag gaggcgacga acggggtgcg ttgctatcag
      181 atttccggag gatttcagga tatttcagaa ctgccagcga aactccagct gaccgaagtg
      241 ggtggaaatg cggagatgca gcgcctgtgg cggcactatt acgcctcctc gcacgccctc
      301 atatactgtt tcgatctggg ttcggatccg gagggactgg aggccacgtt cgccctgctg
      361 acccagtgcc tgaggggcac tcagctggcc ggcaagccgg tgctcctggt cgcctcacgt
      421 catcgcgatg gcgtccagct ctatgacgtg gagtatgcct tcgggctgga ggagctggcc
      481 aggtcctgcg gctgcccgct gctcatctgc cacatggaca gtgccgacga tctgcagcgc
      541 ggcgtccggt ggctctgtca ccagctgttg gccagaaaat cacagctgga tcagcgcatt
      601 cgatacgatg taaatatgca ggtttggcag cgccggaagc gatcgctttt atccagcgga
      661 aagttagccc aagtgcatcg acagcgattt cggagacatt cgcgaaggat attgcctgct
      721 atccagggat ttggaggcat gacaatgcgt ccaagtacag cacctgcaaa cattttcttt
      781 gtgaattgtc gggaacaaga ggaaaatcac aatttctag