PREDICTED: Drosophila takahashii moonshiner (moon), mRNA.

LOCUS       XM_017150195             549 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017150195
VERSION     XM_017150195.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 18, 2021 this sequence version replaced XM_017150195.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..549
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..549
                     /gene="moon"
                     /note="moonshiner; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 2 Proteins"
                     /db_xref="GeneID:108063189"
     CDS             1..549
                     /gene="moon"
                     /codon_start=1
                     /product="moonshiner"
                     /protein_id="XP_017005684.2"
                     /db_xref="GeneID:108063189"
                     /translation="MAGRLSKLLPTDGVFIPESRRFPQELMASVMEGLRDDLGELSLG
                     DRKSLEELHRIWSGKMANRLPESNPRPPSPKKRRLRGKKNDPPAKSPAEPPEEEREER
                     NVFEIDDDEIVTNRICVPRKRSHWKLRYFDIKMPAYVLKRGLLNEHFNWEILEGIMSA
                     PDEEATAMFQQFVDDVVKDLTP"
ORIGIN      
        1 atggccggtc gcctgagtaa gctgttgccc accgatggcg tttttatacc ggagtcgcgc
       61 cgcttcccgc aggaactgat ggccagcgtg atggagggac tgcgcgacga cttgggagaa
      121 ctgagcctcg gggatcgcaa gtcgctggag gaattgcata ggatttggtc ggggaagatg
      181 gccaaccgcc tgccggaatc gaatccgcgt ccgccgtcgc cgaagaagcg ccgcctgcgg
      241 ggcaagaaga acgacccgcc ggcgaagagt ccagcggaac cgccggagga ggagcgcgag
      301 gagcgcaatg tcttcgaaat agacgacgac gagatcgtca ccaaccgcat ctgcgttccg
      361 cggaagcgtt cccattggaa gctgcgctac ttcgacatca agatgcccgc ctacgtcctc
      421 aagaggggct tgctcaatga gcacttcaac tgggagattc tcgaggggat catgtccgcc
      481 cccgacgagg aggccaccgc catgttccag cagttcgtgg acgatgtggt caaggatctg
      541 acgccctaa