Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Cuticular protein 11B (Cpr11B),


LOCUS       XM_017149840             791 bp    mRNA    linear   INV 09-DEC-2024
            mRNA.
ACCESSION   XM_017149840
VERSION     XM_017149840.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017149840.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..791
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..791
                     /gene="Cpr11B"
                     /note="Cuticular protein 11B; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:108062961"
     CDS             113..718
                     /gene="Cpr11B"
                     /codon_start=1
                     /product="endocuticle structural glycoprotein SgAbd-8"
                     /protein_id="XP_017005329.2"
                     /db_xref="GeneID:108062961"
                     /translation="MLRPQLLTVALVLLGFSSASVLAGRLSQRYLPTPQASQLHYHGV
                     SGQGHARPGAGHSFGGVGGGSSFQRQQQPQIPIVRSDYQSDANGNYNFGFDTGNGIHR
                     DETGEFRGGWPHGSLGVQGSYSYTGDDGKQYTVNYKADKNGFQAEGAHLPVSPSVPAA
                     PAGRSSYGAGGGYRGSAPSHVPAPAPATRYLPPGYRQRRHY"
     misc_feature    380..544
                     /gene="Cpr11B"
                     /note="Insect cuticle protein; Region: Chitin_bind_4;
                     pfam00379"
                     /db_xref="CDD:459790"
ORIGIN      
        1 cgttcccaaa tcgagaattc gcataaatct attacttggc tccttttttt tttttttgct
       61 ttttttgcga gtggcctgag tgatctgtga tcttttttcg aaaagcacaa aaatgttgcg
      121 accccagttg ttgaccgttg ccctcgtgct cttgggcttc tcctcggcct ccgttctggc
      181 cggtcgtctt agccagcggt atttgcccac tccgcaggcc agccagctgc actaccacgg
      241 cgtcagtggc cagggacacg ctcgtcctgg cgcaggacat tccttcggcg gcgtcggcgg
      301 cggttccagc ttccagcgcc agcagcaacc ccagatcccc atcgtgagga gcgactacca
      361 gagcgacgcc aatggcaact acaacttcgg cttcgacacg ggcaatggaa tccatcgcga
      421 tgagaccggc gagttccgcg gaggatggcc ccacggatcg ctgggtgtcc agggatccta
      481 ctcgtatacc ggtgacgatg gcaagcagta cactgtgaac tacaaggcgg acaagaatgg
      541 attccaggcg gagggagccc atctgcccgt ttcgccatcg gtgcccgctg ccccagcagg
      601 acgcagctct tatggcgctg gtggtggtta tcgtggttcg gccccgtcgc atgtccctgc
      661 tcctgctccg gctacccgat atctgccccc aggatatcgc cagcgtaggc actattgaag
      721 gataccagcg attggaagga taacccctaa caaccccaac aatctgattc ttaaactgta
      781 aatttcaata a