Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017149840 791 bp mRNA linear INV 09-DEC-2024 mRNA. ACCESSION XM_017149840 VERSION XM_017149840.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017149840.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..791 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..791 /gene="Cpr11B" /note="Cuticular protein 11B; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108062961" CDS 113..718 /gene="Cpr11B" /codon_start=1 /product="endocuticle structural glycoprotein SgAbd-8" /protein_id="XP_017005329.2" /db_xref="GeneID:108062961" /translation="MLRPQLLTVALVLLGFSSASVLAGRLSQRYLPTPQASQLHYHGV SGQGHARPGAGHSFGGVGGGSSFQRQQQPQIPIVRSDYQSDANGNYNFGFDTGNGIHR DETGEFRGGWPHGSLGVQGSYSYTGDDGKQYTVNYKADKNGFQAEGAHLPVSPSVPAA PAGRSSYGAGGGYRGSAPSHVPAPAPATRYLPPGYRQRRHY" misc_feature 380..544 /gene="Cpr11B" /note="Insect cuticle protein; Region: Chitin_bind_4; pfam00379" /db_xref="CDD:459790" ORIGIN 1 cgttcccaaa tcgagaattc gcataaatct attacttggc tccttttttt tttttttgct 61 ttttttgcga gtggcctgag tgatctgtga tcttttttcg aaaagcacaa aaatgttgcg 121 accccagttg ttgaccgttg ccctcgtgct cttgggcttc tcctcggcct ccgttctggc 181 cggtcgtctt agccagcggt atttgcccac tccgcaggcc agccagctgc actaccacgg 241 cgtcagtggc cagggacacg ctcgtcctgg cgcaggacat tccttcggcg gcgtcggcgg 301 cggttccagc ttccagcgcc agcagcaacc ccagatcccc atcgtgagga gcgactacca 361 gagcgacgcc aatggcaact acaacttcgg cttcgacacg ggcaatggaa tccatcgcga 421 tgagaccggc gagttccgcg gaggatggcc ccacggatcg ctgggtgtcc agggatccta 481 ctcgtatacc ggtgacgatg gcaagcagta cactgtgaac tacaaggcgg acaagaatgg 541 attccaggcg gagggagccc atctgcccgt ttcgccatcg gtgcccgctg ccccagcagg 601 acgcagctct tatggcgctg gtggtggtta tcgtggttcg gccccgtcgc atgtccctgc 661 tcctgctccg gctacccgat atctgccccc aggatatcgc cagcgtaggc actattgaag 721 gataccagcg attggaagga taacccctaa caaccccaac aatctgattc ttaaactgta 781 aatttcaata a