PREDICTED: Drosophila takahashii density-regulated protein (DENR),

LOCUS       XM_017148930             735 bp    mRNA    linear   INV 09-DEC-2024
            mRNA.
ACCESSION   XM_017148930
VERSION     XM_017148930.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017148930.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..735
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..735
                     /gene="DENR"
                     /note="density-regulated protein; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:108062321"
     CDS             101..670
                     /gene="DENR"
                     /codon_start=1
                     /product="density-regulated protein homolog"
                     /protein_id="XP_017004419.1"
                     /db_xref="GeneID:108062321"
                     /translation="MTNEDAGTNSVADRLQVGPREGVTYPIQMKYCGHCTMPIEYCEY
                     YPEYEKCKDWLERHMPDDFERLKIEEEAAAADGTDDDKKRQKRGGKGLLRVKKKEDVP
                     KRICVSRAARGKKKSVTVVTGLSTFDIDLKVAAKFFGTKFACGSSVTGDDEIVIQGDV
                     KDDLFDVIPEKWAEIDEDVIEDLGDQKRT"
     misc_feature    176..649
                     /gene="DENR"
                     /note="Eukaryotic initiation factor 1 and related
                     proteins; Region: eIF1_SUI1_like; cl00229"
                     /db_xref="CDD:469673"
     misc_feature    order(434..436,443..448,452..454,506..508,515..523,
                     527..535,539..541,569..571,578..580)
                     /gene="DENR"
                     /note="putative rRNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:211320"
     polyA_site      735
                     /gene="DENR"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttttggtata ttttcgccgc agcttgcgtt gaaaatcatc tgtcgttggc cagatattga
       61 gatatatatt taaaatataa ccccccaaat ccgatccgcg atgacgaacg aggacgcggg
      121 caccaacagc gtcgccgacc gcctgcaggt gggtccgcgc gagggggtca cctatccgat
      181 ccagatgaag tactgcggcc actgcacgat gcccattgag tactgcgagt actatccgga
      241 gtacgagaag tgcaaggact ggctggagcg gcacatgccc gacgacttcg agcggctgaa
      301 gatcgaggag gaggcggccg ccgccgacgg gacggatgac gacaagaagc gccagaagcg
      361 cggcggcaag ggactcctcc gcgtgaagaa gaaggaggac gtgcccaagc gcatctgcgt
      421 ctcgcgggcg gcgcgcggca agaagaagtc ggtcaccgtg gtcacaggac tgagcacttt
      481 cgacatcgat ctcaaggtgg ccgccaagtt ctttggcacc aagttcgcct gcggctcctc
      541 ggtgaccggc gacgacgaga tcgtcatcca gggcgacgtc aaggacgact tgttcgacgt
      601 gatacccgag aagtgggccg agatcgacga ggatgtcatc gaggatttgg gcgatcagaa
      661 gcgaacatga ataatttaat cagtttcctt agcttatttt atacgctaca tcattaaacg
      721 tgatcttctg ggtta