PREDICTED: Drosophila takahashii uncharacterized protein

LOCUS       XM_017148912             910 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108062309), mRNA.
ACCESSION   XM_017148912
VERSION     XM_017148912.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017148912.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 6% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..910
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..910
                     /gene="LOC108062309"
                     /note="uncharacterized LOC108062309; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108062309"
     CDS             1..663
                     /gene="LOC108062309"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_017004401.2"
                     /db_xref="GeneID:108062309"
                     /translation="MRMALANWRAISRGPYKMLQLAEEVFESHEMKLWIILLLCILQL
                     LQGSRSTNYEVIGDEKTMDIVCDAQEDKGNVPLRQILDISGLTFEVAEDLETLYYNGD
                     IKVLMDVPSGPIGMQVDVFRWERNEWIPTPLCLKRDSLCNSLTNPREIWYPLFRKIPK
                     NEMICPPKKGHIYTLNNVSNHEFVRNMPHADIAGDLKAVVHLSSGDLKTCAVVFFKVY
                     VN"
     misc_feature    151..636
                     /gene="LOC108062309"
                     /note="Domains in hypothetical proteins in Drosophila
                     including 2 in CG15241 and CG9329; Region: DM11;
                     smart00675"
                     /db_xref="CDD:128920"
ORIGIN      
        1 atgcgaatgg cgttggctaa ttggcgggca attagtcgag ggccctataa aatgttgcag
       61 ctggcggagg aggtctttga aagtcacgaa atgaagctct ggattatttt gctgctttgc
      121 atcctgcaac tcctgcaggg aagtcggagc accaactacg aggttatcgg cgatgagaaa
      181 accatggaca tcgtttgcga tgcccaagag gacaagggca atgtaccgct tcgtcagatc
      241 ttggacatca gcggcctgac cttcgaggtt gccgaagatc tggagacttt gtactacaac
      301 ggcgacatca aggtgctcat ggatgtgccg agcggtccga ttggcatgca ggtcgacgtc
      361 tttcgctggg aacgaaacga atggatcccg acaccgctct gcctgaaacg cgacagcttg
      421 tgcaattcct tgaccaatcc tcgggagatc tggtatccgc tgttcagaaa aatccccaag
      481 aacgagatga tatgtccgcc caaaaaaggt cacatctaca ccctgaacaa cgtgagcaac
      541 catgagtttg tgcggaacat gccccatgcg gacattgctg gggacctgaa ggccgtggtc
      601 cacctgagct ccggggacct gaagacctgt gctgtggtct tcttcaaggt ctacgtaaat
      661 tgagggggga tggtgacatc cagtggaccc tgacagtgga cgaggggatc gcgttgggat
      721 ccggctgttt gcctagttta tagtacgcgg ctgctctgct tttatggcct gattcggcgg
      781 tgtttgctcg gcttcaatgg cgcgtcccac cgtttatggc tctaactaaa tgatttgcaa
      841 ataaagggaa atatttcata ttcatgcact cgaaacagaa tgccagaaat gtcggttttt
      901 tggttatttc