Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii glyoxalase domain-containing


LOCUS       XM_017148903            1207 bp    mRNA    linear   INV 09-DEC-2024
            protein 4 (LOC108062300), mRNA.
ACCESSION   XM_017148903
VERSION     XM_017148903.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017148903.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1207
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1207
                     /gene="LOC108062300"
                     /note="glyoxalase domain-containing protein 4; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:108062300"
     CDS             112..978
                     /gene="LOC108062300"
                     /codon_start=1
                     /product="glyoxalase domain-containing protein 4"
                     /protein_id="XP_017004392.2"
                     /db_xref="GeneID:108062300"
                     /translation="MSAISGRALHYVFKIGDRAKNSFFFRQILGMTVLRHEEFKEGCD
                     AECNGPYDNRWSKTMVGYGPESSHFVIELTYNYGVSSYEMGNDFGGVTIHSKDILSRA
                     AEHSYPVTQVPGKPGSLLTSPDGYKFYVIDQQSASSDPVQSVELHVSNLQSSRKYWHD
                     LLQLQLLEESEGGLRLSYGAQQASLQITQIAEAINRAKAYGRVAFAIPAAQQPPLQEA
                     VKAAGGTILTPLITLDTPGKATVSVVILGDPDGHEICFVDEEGFGQLSQVEPDGAQRL
                     DRYIEKDPFQAK"
     misc_feature    127..510
                     /gene="LOC108062300"
                     /note="N-terminal domain of human glyoxalase
                     domain-containing protein 4 and similar proteins; Region:
                     GLOD4_N; cd08358"
                     /db_xref="CDD:319946"
     misc_feature    538..879
                     /gene="LOC108062300"
                     /note="C-terminal domain of human glyoxalase
                     domain-containing protein 4 and similar proteins; Region:
                     GLOD4_C; cd16357"
                     /db_xref="CDD:319964"
     misc_feature    order(538..540,550..552,631..633,667..669,673..675,
                     715..717,844..846,868..870,874..876)
                     /gene="LOC108062300"
                     /note="putative active site [active]"
                     /db_xref="CDD:319964"
     polyA_site      1207
                     /gene="LOC108062300"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gtcacaccat cctgaatgta cataaacaag gtcgaaattc gctcgtaaaa cattttcccc
       61 caaaactcgg agcacgctga tcaaagtccc agtaaacaaa accccccaaa gatgtcggcc
      121 atttcgggac gtgcacttca ctacgttttc aagatcggag atcgcgcgaa aaactcattt
      181 ttctttcgcc aaatcttggg aatgacggtg ctgcggcatg aggagttcaa ggagggatgc
      241 gatgccgagt gcaacgggcc ctacgacaac cggtggagca aaacgatggt gggctatgga
      301 cccgaaagtt cgcatttcgt catcgaactg acgtataact atggagtgag cagctacgaa
      361 atgggcaacg actttggcgg cgtgaccata cattccaagg acattctttc ccgggccgcc
      421 gagcactcgt atcctgttac ccaggtgcct ggcaagccgg gcagtctgct tacctcgccc
      481 gatggctaca agttctatgt gatcgatcag cagtcggcca gctccgatcc tgtccagtcg
      541 gtggagctgc atgtgagcaa tctccagagc tcgaggaagt actggcacga cttactccag
      601 ctgcagttgc tcgaggagag cgagggcggc ctgcgtttga gttacggcgc ccagcaggct
      661 tcgctgcaga tcacccagat cgcagaggcc attaaccgag ccaaggccta tggccgcgtt
      721 gccttcgcca ttccggcggc ccagcagccg ccgcttcagg aggccgtcaa ggcggccggc
      781 ggcaccattt tgacgcccct catcacgctg gacacgccgg gcaaggccac cgtttcggtg
      841 gtgatcctcg gcgatcccga tggccatgag atctgcttcg tcgacgagga gggcttcggc
      901 cagttgtcgc aggtggagcc cgatggcgcc cagcggctgg acagatacat cgagaaggat
      961 cccttccagg cgaagtgatg atcccagcga cccagcgatc ccagcgagca ctgatatttg
     1021 tacacaccac cctgtatttt ggattctatg gtttttggct gtctttgatg gagatatata
     1081 ttattttacc gcacacttga aatgttatat atgatattat acacctaggc ccgagctttg
     1141 cctgttgatc gagaaaaagg ccttgaagta cttacatttc gtttacataa actgtcgata
     1201 aacctta