Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017148900 829 bp mRNA linear INV 09-DEC-2024 (LOC108062297), transcript variant X2, mRNA. ACCESSION XM_017148900 VERSION XM_017148900.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017148900.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..829 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..829 /gene="LOC108062297" /note="uncharacterized LOC108062297; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:108062297" CDS 296..691 /gene="LOC108062297" /codon_start=1 /product="uncharacterized protein isoform X2" /protein_id="XP_017004389.1" /db_xref="GeneID:108062297" /translation="MSHGERKGRLNVVKFLELGFAVACLVLHFYSFNDRDIMTSFLAT GTFTGYIIVVIGVFAGVLMRAPIHKRIDIFFSVLGCTLFVASGVFIIEAWEFSFRTRT RDLALIKASLSIVNGVLFGFDAVFTFRDK" ORIGIN 1 cacagacgga cccgagaggc cccgagaata gcaaacgtga acggatgaaa agcctatttc 61 ctaagtgtaa ttaattaatt tcggtggctg tgacggtgac tgcgcccaac tgcaagcagc 121 agttgcctgc tgcatccgac atctccgaca tccattcgat tcagtttatc cagcgcactg 181 tcgtcgcgaa cacgtccaga ataactcgaa aaaatctgtt ttcgtattac ggaatttacg 241 gattatcaaa ctggatcaca ttttcgagga cggtcagcgg cagcagtttc acaaaatgtc 301 ccacggcgag cgaaaaggcc gcctgaatgt ggtcaagttt ctggaattgg gctttgcggt 361 agcgtgtcta gtgcttcact tctacagctt taatgatcgc gatattatga cctcgttttt 421 ggccactggc acctttacgg gctacatcat agtggtgatc ggggtatttg caggtgttct 481 gatgcgggcc cccattcaca agcgcatcga cattttcttc agtgtcctgg gctgcactct 541 gttcgtggcc agcggcgtgt tcatcatcga ggcctgggag ttctcgttcc gcaccagaac 601 tcgggatctc gcgctcatca aggcctcgtt gtccatcgtc aatggggtgc tgttcggatt 661 cgatgccgtc ttcacatttc gcgacaagtg aatcatcgct ttttttgagc cactggacac 721 cattttgcca aatcctctgg agcttctttt ttgtgcattt aatagttgta agaatatata 781 tatatttttt tcgtcgccct aaattgtact tccactagac cttaaaaac