Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii nuclear transport factor-2


LOCUS       XM_017148897            1317 bp    mRNA    linear   INV 09-DEC-2024
            (Ntf-2), mRNA.
ACCESSION   XM_017148897
VERSION     XM_017148897.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017148897.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1317
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1317
                     /gene="Ntf-2"
                     /note="nuclear transport factor-2; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 4
                     Proteins"
                     /db_xref="GeneID:108062296"
     CDS             179..571
                     /gene="Ntf-2"
                     /codon_start=1
                     /product="probable nuclear transport factor 2"
                     /protein_id="XP_017004386.1"
                     /db_xref="GeneID:108062296"
                     /translation="MSLNPQYEDIGKGFVQQYYAIFDDPANRANVVNFYSATDSFMTF
                     EGHQIQGAPKILEKVQSLSFQKITRVITTVDSQPTFDGGVLINVLGRLQCDDDPPHAF
                     SQVFVLKANAGTFFVAHDIFRLNIHNSA"
     misc_feature    194..553
                     /gene="Ntf-2"
                     /note="Nuclear transport factor 2 (NTF2) domain plays an
                     important role in the trafficking of macromolecules, ions
                     and small molecules between the cytoplasm and nucleus.
                     This bi-directional transport of macromolecules across the
                     nuclear envelope requires many...; Region: NTF2; cd00780"
                     /db_xref="CDD:238403"
     misc_feature    order(284..286,305..307,326..328,401..403,407..412,
                     437..439,503..505,533..541,545..547,551..553)
                     /gene="Ntf-2"
                     /note="TAP/p15 interaction [active]"
                     /db_xref="CDD:238403"
     misc_feature    order(299..301,305..310,392..397,401..403,407..412,
                     431..433,443..451,461..463,467..478,485..487,503..505,
                     533..541,545..553)
                     /gene="Ntf-2"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238403"
     misc_feature    order(308..313,362..364,377..379,446..448,452..454,
                     458..463,467..469,476..478,542..544,548..550)
                     /gene="Ntf-2"
                     /note="RanGDP-NTF2 interaction [active]"
                     /db_xref="CDD:238403"
     polyA_site      1317
                     /gene="Ntf-2"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cgttgtttct atcgactccc gaccacctct agtgcgctgc gcctcgcaaa aaaaatttgg
       61 ttggttttat tttaattttt cggaatacgt cgtgtgccgc tcgatcggat cggattgctc
      121 accagcccgc ctttgcccgc ttacctttcg tcgcaccttc cgccttccca cgagtgaaat
      181 gtcgctgaat ccgcagtacg aggacatcgg caagggcttt gtgcagcagt actatgcgat
      241 attcgatgac ccggcgaacc gggcgaacgt ggtcaacttc tacagcgcta ccgactcctt
      301 tatgaccttt gaaggtcacc aaatacaggg tgcgcccaag atcctcgaga aagtccagag
      361 cctgagtttt cagaagatta cacgagtgat aaccacagtg gactcgcagc ccactttcga
      421 tggcggagtg ctgatcaatg tcctcggaag gctacagtgc gacgacgatc ccccgcacgc
      481 cttctcgcag gttttcgtcc tgaaggccaa tgccggcacc ttcttcgtcg cccacgacat
      541 cttccgtctg aacatccaca actctgccta ggaacccggg agcctgggag cctccacacc
      601 actcagcaac aacacactca acacgacatc caaagatgcc taacgacaac cacaacaaca
      661 accagctggc agaggaacac tcaatgggaa gcacagcata acaaagcaga agcagcggtc
      721 tcacgtttat caacaaatga aaaaaaccca cacaataaac aaaaaaaaaa gaagaaatta
      781 atttgtaact actattacga tgtgtaaaca aaatgggcca ccagcagctc acctatacca
      841 ttaccattgt gtccccaaac tgtactgctc tcggtactct cgatttacca ttgtatattc
      901 cgcgaacaac acctggatct cgggatctaa tttagctagg gctatcaaat ttggtatgtg
      961 gtctgcgacg agcttgcttt tgcgtttgcc ccggaaaaga atcaaaaaac acacatagtt
     1021 ggcaactact taaattaaaa gtgacatttt ctattatata tatattttgt ttgagttgat
     1081 tgaccttgaa tttcgattat gtactgtaat tattgaaata attttagata gccgtattgc
     1141 aaatgttttc tatcgaattt tccccccact ttgtaaacca tgatcggagt accgggatat
     1201 tattacttag tcgagagaat atcgacgcta gctttcttgt atgactaatt gagtgatggc
     1261 gaattacttt ttattgagac aaaaaaaaga acacttaaat ataaagatta acgttaa