Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017148891 906 bp mRNA linear INV 09-DEC-2024 ACCESSION XM_017148891 VERSION XM_017148891.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017148891.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..906 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..906 /gene="I-3" /note="Inhibitor-3; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108062292" CDS 100..693 /gene="I-3" /codon_start=1 /product="uncharacterized protein I-3" /protein_id="XP_017004380.2" /db_xref="GeneID:108062292" /translation="MDQPKAMLSTIDGETTENRGSMKVTTTDSGFNSADSTDSADQVA LATPPSLLRLRLAAQSEQPTMTTPSRRRVGFHAGVIDNEHMNRRKSKCCCIYRRPHPF GESSSSTDDECDNCFGHPEVRTRNRLEKLEKRRQAEQNCGCGCHCHHHRTHRHINRNN RLPIGEIAAEKDNNRDEEEPKAVIKNRNKSTGEIEKV" misc_feature 253..438 /gene="I-3" /note="Protein phosphatase inhibitor; Region: PPI_Ypi1; pfam07491" /db_xref="CDD:429489" polyA_site 906 /gene="I-3" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cagaaaacag ataacccatt tcggaacgag tttttttttt aagtcgccaa aatttcgtag 61 cgtttttttc ttttattttt aatttttttt tttttgccca tggatcagcc gaaggccatg 121 ttatcgacta tcgatggcga gacgacggag aacagaggct ccatgaaggt gacgacgaca 181 gattcgggat tcaattcggc cgatagcacg gattccgcag atcaagtggc cctggccact 241 ccccccagcc tgctgcgcct tcgattggcg gcacaatcgg agcagccgac gatgacgacg 301 cccagccgaa ggcgcgtcgg cttccatgcc ggcgttatcg ataacgagca catgaatcgc 361 cgaaaatcga agtgctgttg catctatcga aggccgcatc ccttcggcga gagttcctcc 421 tcgacggacg acgagtgcga taactgtttc gggcatccgg aggtgagaac ccgcaatcgg 481 ctggagaagc tggagaagcg gaggcaggct gagcaaaact gcggctgtgg ctgtcactgt 541 catcatcacc gcactcatcg ccacattaat cggaataatc gactgcctat cggagagatc 601 gcggcggaaa aggacaataa tagagatgaa gaggagccaa aggcggtgat caagaatcga 661 aataaatcga ctggcgaaat tgaaaaagtt tagaagggca gaaacgccac attaatcgaa 721 atagtcggca acctatcggg gagattgcgg cggaaaaggg caataaccgg gatgacgagg 781 agccaatggc gaatggtgta gaacggcaga tcattggaaa attctgtgtg ctaaaatatg 841 tggaaagaaa aaaattggtt tgtgtttgga ttcaataata ataaaattat gaaatggtat 901 atataa