PREDICTED: Drosophila takahashii angiopoietin-related protein

LOCUS       XM_017148881             909 bp    mRNA    linear   INV 09-DEC-2024
            1-like (LOC108062286), mRNA.
ACCESSION   XM_017148881
VERSION     XM_017148881.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 18, 2021 this sequence version replaced XM_017148881.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..909
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..909
                     /gene="LOC108062286"
                     /note="angiopoietin-related protein 1-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 22 Proteins"
                     /db_xref="GeneID:108062286"
     CDS             1..909
                     /gene="LOC108062286"
                     /codon_start=1
                     /product="angiopoietin-related protein 1-like"
                     /protein_id="XP_017004370.2"
                     /db_xref="GeneID:108062286"
                     /translation="MTEIIRNLQTQLVNAEAQLKINDKEIIDKSEQLKQNEDQIKDQT
                     NQIQNKDEELVIKTNAVKDLSAQISTKDNQINGLNNQIKSVSEDLERSKKYFGSDECP
                     KSGPSGIYVLKVPGNVLMEVPCNSTGWIVVLRRQDGSVDFQRRWMEYKDGFGNLTGEF
                     FIGLEKLHQLTKGRSYHLYIKLVDVHGSVVYAQYDNFKVSNEENKYRLDSVGKYSGTA
                     GDSLAYNADEYFTTIDRDNDANSGNCAISYSGGGWWYSSCSFSFLTGKFYKDGISPDY
                     GGINWHYYRNDETTSFTYVEMLIKPK"
     misc_feature    25..>291
                     /gene="LOC108062286"
                     /note="Septal ring factor EnvC, activator of murein
                     hydrolases AmiA and AmiB [Cell cycle control, cell
                     division, chromosome partitioning]; Region: EnvC; COG4942"
                     /db_xref="CDD:443969"
     misc_feature    316..906
                     /gene="LOC108062286"
                     /note="Fibrinogen-related domains (FReDs); C terminal
                     globular domain of fibrinogen. Fibrinogen is involved in
                     blood clotting, being activated by thrombin to assemble
                     into fibrin clots. The N-termini of 2 times 3 chains come
                     together to form a globular...; Region: FReD; cd00087"
                     /db_xref="CDD:238040"
     misc_feature    619..621
                     /gene="LOC108062286"
                     /note="gamma-gamma dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238040"
     misc_feature    order(706..708,712..714,718..720)
                     /gene="LOC108062286"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238040"
     misc_feature    order(730..732,739..744,772..777)
                     /gene="LOC108062286"
                     /note="polymerization pocket [active]"
                     /db_xref="CDD:238040"
ORIGIN      
        1 atgacggaaa ttataagaaa cttacagact cagttagtaa atgctgaggc ccaattaaaa
       61 atcaacgata aggaaataat tgataaaagt gaacaactta aacaaaacga agatcaaatt
      121 aaggatcaaa ctaatcagat ccagaacaaa gatgaagaac ttgttattaa aactaatgca
      181 gttaaggact tgagtgccca gatttcgacg aaggataacc agatcaatgg gctcaacaat
      241 cagattaaat cggtttctga agatttggaa cgaagtaaga agtattttgg atccgatgag
      301 tgtcccaaaa gcggtccaag tggcatttac gtattaaaag tccccggaaa tgttttaatg
      361 gaagttccct gcaactccac tggttggatt gttgttctaa ggcggcagga cggatcggtt
      421 gactttcaac gcagatggat ggaatataag gacggctttg gcaacttaac aggcgaattt
      481 ttcattggtc tggagaaact acaccaactg actaagggac gatcttacca cctctacatc
      541 aagttagtcg acgtacatgg atcggttgtg tacgctcagt acgataactt taaggttagc
      601 aacgaggaaa acaagtatcg tctagactcg gttggtaaat actctggtac agcaggagat
      661 tctctagcct acaatgcgga tgaatacttt accacaattg atcgagataa tgacgctaat
      721 tcgggtaatt gtgcgatatc ttactctggc ggtggttggt ggtacagcag ttgcagtttc
      781 agttttctta ctggaaagtt ctataaggat ggaatttcac cagattatgg aggaataaat
      841 tggcactact atcggaacga cgaaacgacc tcattcacct atgttgaaat gctgattaag
      901 ccaaaataa