Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017148878             258 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108062283), mRNA.
ACCESSION   XM_017148878
VERSION     XM_017148878.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; corrected model.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017148878.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            frameshifts :: corrected 2 indels
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-39                JARPSC010000001.1  15285515-15285553   c
            40-126              JARPSC010000001.1  15285427-15285513   c
            127-258             JARPSC010000001.1  15285293-15285424   c
FEATURES             Location/Qualifiers
     source          1..258
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..258
                     /gene="LOC108062283"
                     /note="uncharacterized LOC108062283; The sequence of the
                     model RefSeq transcript was modified relative to its
                     source genomic sequence to represent the inferred CDS:
                     deleted 3 bases in 2 codons; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108062283"
     CDS             1..258
                     /gene="LOC108062283"
                     /note="The sequence of the model RefSeq protein was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: deleted 3 bases in 2 codons"
                     /codon_start=1
                     /product="LOW QUALITY PROTEIN: uncharacterized protein"
                     /protein_id="XP_017004367.3"
                     /db_xref="GeneID:108062283"
                     /translation="MGPSMEEDYRMQDQDATFCSCFHVFMAQIIAVINNNKNKTAGGQ
                     DQDDRIGSWFLRTGMWGSKDELRDVDADAISTEFCSINDKL"
ORIGIN      
        1 atggggccgt cgatggagga ggattacagg atgcaggacc aggacgccac cttttgcagc
       61 tgcttccatg tgttcatggc gcaaataatc gccgtcatca acaacaacaa aaacaagacg
      121 gcaggaggac aggatcagga cgacaggatt gggtcctggt tcctgagaac ggggatgtgg
      181 gggtccaaag atgagttgag agacgttgac gctgacgcca ttagcaccga gttttgcagc
      241 atcaacgaca aactttaa