PREDICTED: Drosophila takahashii uncharacterized protein

LOCUS       XM_017148878             258 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108062283), mRNA.
ACCESSION   XM_017148878
VERSION     XM_017148878.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; corrected model.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017148878.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            frameshifts :: corrected 2 indels
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-39                JARPSC010000001.1  15285515-15285553   c
            40-126              JARPSC010000001.1  15285427-15285513   c
            127-258             JARPSC010000001.1  15285293-15285424   c
FEATURES             Location/Qualifiers
     source          1..258
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..258
                     /gene="LOC108062283"
                     /note="uncharacterized LOC108062283; The sequence of the
                     model RefSeq transcript was modified relative to its
                     source genomic sequence to represent the inferred CDS:
                     deleted 3 bases in 2 codons; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108062283"
     CDS             1..258
                     /gene="LOC108062283"
                     /note="The sequence of the model RefSeq protein was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: deleted 3 bases in 2 codons"
                     /codon_start=1
                     /product="LOW QUALITY PROTEIN: uncharacterized protein"
                     /protein_id="XP_017004367.3"
                     /db_xref="GeneID:108062283"
                     /translation="MGPSMEEDYRMQDQDATFCSCFHVFMAQIIAVINNNKNKTAGGQ
                     DQDDRIGSWFLRTGMWGSKDELRDVDADAISTEFCSINDKL"
ORIGIN      
        1 atggggccgt cgatggagga ggattacagg atgcaggacc aggacgccac cttttgcagc
       61 tgcttccatg tgttcatggc gcaaataatc gccgtcatca acaacaacaa aaacaagacg
      121 gcaggaggac aggatcagga cgacaggatt gggtcctggt tcctgagaac ggggatgtgg
      181 gggtccaaag atgagttgag agacgttgac gctgacgcca ttagcaccga gttttgcagc
      241 atcaacgaca aactttaa