Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017148877 427 bp mRNA linear INV 09-DEC-2024 (LOC108062282), mRNA. ACCESSION XM_017148877 VERSION XM_017148877.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017148877.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..427 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..427 /gene="LOC108062282" /note="uncharacterized LOC108062282; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108062282" CDS 89..397 /gene="LOC108062282" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_017004366.2" /db_xref="GeneID:108062282" /translation="MDVKQQMQDVNQDRGKVATVSKDLELELEHAEDLSRNSSLTTVC STFPLTSRIDSYHRWHSEIGVNEGEEAEDIMNRQLEVEGERKVQLAIAMPLAIEAIHP " polyA_site 427 /gene="LOC108062282" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gtcaaccgaa attgataaat tccctttgaa ttccgattgg gccctgactt agtgataaaa 61 attcaaaaaa atatccttaa taataataat ggatgtgaag caacagatgc aggatgtgaa 121 tcaggatcgc ggcaaggtgg ccacggtcag caaggacctc gagctggagc tggagcacgc 181 cgaggacctg agtcggaact ccagtctgac cactgtgtgc agcacctttc cgttgacctc 241 gcgaatcgac agctatcacc gctggcactc ggagatcggg gtaaatgagg gtgaggaggc 301 ggaggatatc atgaatcgcc aactggaagt ggagggtgag cgaaaggtcc agctggccat 361 cgccatgccg ctcgccattg aagccataca tccttgatgc caaaatgaat aaattctagt 421 tttatta