Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Serine protease 6 (LOC108062275),


LOCUS       XM_017148870             920 bp    mRNA    linear   INV 09-DEC-2024
            mRNA.
ACCESSION   XM_017148870
VERSION     XM_017148870.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017148870.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..920
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..920
                     /gene="LOC108062275"
                     /note="Serine protease 6; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:108062275"
     CDS             15..797
                     /gene="LOC108062275"
                     /codon_start=1
                     /product="serine protease SP24D"
                     /protein_id="XP_017004359.2"
                     /db_xref="GeneID:108062275"
                     /translation="MKTSRVLLVVSSLLFLGLVLPVQSAPGKLNGRVVGGEDAAKAQF
                     PHQVSLRNAGSHSCGGSIISRNYILTAAHCVTNEDENGNHLAIEAARFTIRAGSNDRF
                     SGGVLHQVAEVIVHEAYGDFMNDVALLRLETPLILSSSIQIIQLPSVDTPADVDVIIS
                     GWGRIKHQGDLPRYLQYNTLKSISTEQCEELIEFGFEGELCLLHVVDNGACNGDSGGP
                     AIYNNQLVGVAGFVVGGCGSTYPDGYARVFYFKDWIKKHSDV"
     misc_feature    108..776
                     /gene="LOC108062275"
                     /note="Trypsin-like serine protease; Region: Tryp_SPc;
                     smart00020"
                     /db_xref="CDD:214473"
     misc_feature    111..113
                     /gene="LOC108062275"
                     /note="cleavage site [active]"
                     /db_xref="CDD:238113"
     misc_feature    order(231..233,387..389,657..659)
                     /gene="LOC108062275"
                     /note="active site"
                     /db_xref="CDD:238113"
     misc_feature    order(639..641,702..704,708..710)
                     /gene="LOC108062275"
                     /note="substrate binding sites [chemical binding]; other
                     site"
                     /db_xref="CDD:238113"
     polyA_site      920
                     /gene="LOC108062275"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttgaatttgt gaaaatgaaa acgagccgag ttttgcttgt cgtcagctct ttgctgttcc
       61 tcggcctggt gctgcccgta cagtcggcac ccggcaagct gaacggccgt gtggtgggcg
      121 gtgaggatgc cgcgaaggcg cagtttcccc accaggtgtc gctgcggaac gccggttcgc
      181 atagttgcgg tggttcgatt atttcgagga actacatcct aaccgccgcc cattgtgtga
      241 ccaacgagga tgagaacggc aatcacttgg ccatcgaagc ggctcgtttc accattcgag
      301 cgggttcgaa tgatcgattc agtggcggag tcctccacca ggtggccgag gtgatcgtgc
      361 acgaggccta tggcgacttt atgaacgatg tggccttgct gcgactggaa accccgctga
      421 tcctctctag cagcattcag atcatccaac tgcccagcgt ggacacaccg gcggatgtgg
      481 atgtcatcat ctcgggctgg ggaaggatca agcatcaggg cgatttgccc cgctatctgc
      541 agtacaacac cttgaagtcg atatccacgg agcagtgcga ggagctgatc gagttcggat
      601 tcgagggcga actgtgcctc ctccacgtgg tggacaacgg ggcctgcaac ggggactccg
      661 gcggtccggc catctacaac aaccagctgg tgggcgtggc cgggttcgtg gtgggcggct
      721 gcgggtccac ctatcccgat ggttacgcca gggtgttcta cttcaaggac tggatcaaga
      781 agcactcgga tgtctgagga aatcgtagga aataatatta atattaaata atattttttt
      841 tttacccata aaaataataa ataacatttc aaggaaaata aatgatttta tataactttg
      901 gttgcttgcc ataatgacaa