Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017148870 920 bp mRNA linear INV 09-DEC-2024 mRNA. ACCESSION XM_017148870 VERSION XM_017148870.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017148870.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..920 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..920 /gene="LOC108062275" /note="Serine protease 6; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108062275" CDS 15..797 /gene="LOC108062275" /codon_start=1 /product="serine protease SP24D" /protein_id="XP_017004359.2" /db_xref="GeneID:108062275" /translation="MKTSRVLLVVSSLLFLGLVLPVQSAPGKLNGRVVGGEDAAKAQF PHQVSLRNAGSHSCGGSIISRNYILTAAHCVTNEDENGNHLAIEAARFTIRAGSNDRF SGGVLHQVAEVIVHEAYGDFMNDVALLRLETPLILSSSIQIIQLPSVDTPADVDVIIS GWGRIKHQGDLPRYLQYNTLKSISTEQCEELIEFGFEGELCLLHVVDNGACNGDSGGP AIYNNQLVGVAGFVVGGCGSTYPDGYARVFYFKDWIKKHSDV" misc_feature 108..776 /gene="LOC108062275" /note="Trypsin-like serine protease; Region: Tryp_SPc; smart00020" /db_xref="CDD:214473" misc_feature 111..113 /gene="LOC108062275" /note="cleavage site [active]" /db_xref="CDD:238113" misc_feature order(231..233,387..389,657..659) /gene="LOC108062275" /note="active site" /db_xref="CDD:238113" misc_feature order(639..641,702..704,708..710) /gene="LOC108062275" /note="substrate binding sites [chemical binding]; other site" /db_xref="CDD:238113" polyA_site 920 /gene="LOC108062275" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ttgaatttgt gaaaatgaaa acgagccgag ttttgcttgt cgtcagctct ttgctgttcc 61 tcggcctggt gctgcccgta cagtcggcac ccggcaagct gaacggccgt gtggtgggcg 121 gtgaggatgc cgcgaaggcg cagtttcccc accaggtgtc gctgcggaac gccggttcgc 181 atagttgcgg tggttcgatt atttcgagga actacatcct aaccgccgcc cattgtgtga 241 ccaacgagga tgagaacggc aatcacttgg ccatcgaagc ggctcgtttc accattcgag 301 cgggttcgaa tgatcgattc agtggcggag tcctccacca ggtggccgag gtgatcgtgc 361 acgaggccta tggcgacttt atgaacgatg tggccttgct gcgactggaa accccgctga 421 tcctctctag cagcattcag atcatccaac tgcccagcgt ggacacaccg gcggatgtgg 481 atgtcatcat ctcgggctgg ggaaggatca agcatcaggg cgatttgccc cgctatctgc 541 agtacaacac cttgaagtcg atatccacgg agcagtgcga ggagctgatc gagttcggat 601 tcgagggcga actgtgcctc ctccacgtgg tggacaacgg ggcctgcaac ggggactccg 661 gcggtccggc catctacaac aaccagctgg tgggcgtggc cgggttcgtg gtgggcggct 721 gcgggtccac ctatcccgat ggttacgcca gggtgttcta cttcaaggac tggatcaaga 781 agcactcgga tgtctgagga aatcgtagga aataatatta atattaaata atattttttt 841 tttacccata aaaataataa ataacatttc aaggaaaata aatgatttta tataactttg 901 gttgcttgcc ataatgacaa