Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii serine protease SP24D


LOCUS       XM_017148869             905 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108062274), mRNA.
ACCESSION   XM_017148869
VERSION     XM_017148869.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017148869.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..905
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..905
                     /gene="LOC108062274"
                     /note="serine protease SP24D; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 5
                     Proteins"
                     /db_xref="GeneID:108062274"
     CDS             23..808
                     /gene="LOC108062274"
                     /codon_start=1
                     /product="serine protease SP24D"
                     /protein_id="XP_017004358.2"
                     /db_xref="GeneID:108062274"
                     /translation="MRAARLAAIGTLLASCLLVLPVQSAPGTPEGRVVGGEDAAKAQF
                     PHQVSLRNAGSHSCGGSIISRNFILTAAHCVTTQDASGNLVAYDADRFTIRAGSNDRL
                     SGGVLAQVAKVIVHEEYGNFLNDVALLQLETPLILSSNIQPIDLPTADTPVDSDVIIS
                     GWGRIKHQGDLPRYLQYNTLKSISLERCDDLIGWGVQSELCLIHEADNGACNGDSGGP
                     AIYNNQVVGVAGFVWSACGTSYPDGYARVYFHNDWIRANSDVK"
     misc_feature    116..784
                     /gene="LOC108062274"
                     /note="Trypsin-like serine protease; Region: Tryp_SPc;
                     smart00020"
                     /db_xref="CDD:214473"
     misc_feature    119..121
                     /gene="LOC108062274"
                     /note="cleavage site [active]"
                     /db_xref="CDD:238113"
     misc_feature    order(239..241,395..397,665..667)
                     /gene="LOC108062274"
                     /note="active site"
                     /db_xref="CDD:238113"
     polyA_site      905
                     /gene="LOC108062274"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttgggctttg gccatttgga aaatgagagc cgctcgactt gctgctattg gaacgctgct
       61 ggccagctgt ttgctggtgc tgcccgtaca gtcggcaccc ggtacaccgg aaggccgtgt
      121 ggtgggcggt gaggatgccg cgaaggcgca gtttccccac caggtgtcgc tgcggaatgc
      181 cggttcgcac agttgcggtg gttcgattat ttcgaggaac ttcatcctaa ccgccgccca
      241 ttgtgtgacc acccaggatg cgagtggcaa tctcgttgca tatgacgccg atcgtttcac
      301 cattcgagcg ggttccaatg atcgcctgag tggcggcgtt cttgcccagg tggccaaggt
      361 gattgtccac gaggagtacg ggaatttcct caacgatgtg gccctgctgc aactggaaac
      421 cccactgatc ctgtccagca acatccagcc catcgatttg cccaccgccg acacgcccgt
      481 cgactcggac gtcatcatct cgggctgggg aaggatcaag caccagggcg atttgccgcg
      541 ctatctgcag tacaacacct tgaagtccat atcgctggag aggtgcgacg acctcattgg
      601 ctggggggtg cagagcgagc tgtgcctcat ccacgaggcc gacaacgggg cctgcaacgg
      661 ggactccggc ggcccggcca tctacaacaa ccaggtggtg ggcgtggccg ggttcgtttg
      721 gtccgcctgc ggaaccagct acccggatgg ttatgccagg gtttacttcc acaacgattg
      781 gatcagggcg aactcggatg tgaaatagat ataaagtttg tctgcagatt gataactaaa
      841 taaaatgtcg atcgattatt gaaagttttg agtcggacta tcgataatat cgattatttg
      901 tcata