Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017148869 905 bp mRNA linear INV 09-DEC-2024 (LOC108062274), mRNA. ACCESSION XM_017148869 VERSION XM_017148869.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017148869.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..905 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..905 /gene="LOC108062274" /note="serine protease SP24D; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins" /db_xref="GeneID:108062274" CDS 23..808 /gene="LOC108062274" /codon_start=1 /product="serine protease SP24D" /protein_id="XP_017004358.2" /db_xref="GeneID:108062274" /translation="MRAARLAAIGTLLASCLLVLPVQSAPGTPEGRVVGGEDAAKAQF PHQVSLRNAGSHSCGGSIISRNFILTAAHCVTTQDASGNLVAYDADRFTIRAGSNDRL SGGVLAQVAKVIVHEEYGNFLNDVALLQLETPLILSSNIQPIDLPTADTPVDSDVIIS GWGRIKHQGDLPRYLQYNTLKSISLERCDDLIGWGVQSELCLIHEADNGACNGDSGGP AIYNNQVVGVAGFVWSACGTSYPDGYARVYFHNDWIRANSDVK" misc_feature 116..784 /gene="LOC108062274" /note="Trypsin-like serine protease; Region: Tryp_SPc; smart00020" /db_xref="CDD:214473" misc_feature 119..121 /gene="LOC108062274" /note="cleavage site [active]" /db_xref="CDD:238113" misc_feature order(239..241,395..397,665..667) /gene="LOC108062274" /note="active site" /db_xref="CDD:238113" polyA_site 905 /gene="LOC108062274" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ttgggctttg gccatttgga aaatgagagc cgctcgactt gctgctattg gaacgctgct 61 ggccagctgt ttgctggtgc tgcccgtaca gtcggcaccc ggtacaccgg aaggccgtgt 121 ggtgggcggt gaggatgccg cgaaggcgca gtttccccac caggtgtcgc tgcggaatgc 181 cggttcgcac agttgcggtg gttcgattat ttcgaggaac ttcatcctaa ccgccgccca 241 ttgtgtgacc acccaggatg cgagtggcaa tctcgttgca tatgacgccg atcgtttcac 301 cattcgagcg ggttccaatg atcgcctgag tggcggcgtt cttgcccagg tggccaaggt 361 gattgtccac gaggagtacg ggaatttcct caacgatgtg gccctgctgc aactggaaac 421 cccactgatc ctgtccagca acatccagcc catcgatttg cccaccgccg acacgcccgt 481 cgactcggac gtcatcatct cgggctgggg aaggatcaag caccagggcg atttgccgcg 541 ctatctgcag tacaacacct tgaagtccat atcgctggag aggtgcgacg acctcattgg 601 ctggggggtg cagagcgagc tgtgcctcat ccacgaggcc gacaacgggg cctgcaacgg 661 ggactccggc ggcccggcca tctacaacaa ccaggtggtg ggcgtggccg ggttcgtttg 721 gtccgcctgc ggaaccagct acccggatgg ttatgccagg gtttacttcc acaacgattg 781 gatcagggcg aactcggatg tgaaatagat ataaagtttg tctgcagatt gataactaaa 841 taaaatgtcg atcgattatt gaaagttttg agtcggacta tcgataatat cgattatttg 901 tcata