Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017146975 411 bp mRNA linear INV 09-DEC-2024 (LOC108061005), mRNA. ACCESSION XM_017146975 VERSION XM_017146975.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017146975.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..411 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..411 /gene="LOC108061005" /note="uncharacterized LOC108061005; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:108061005" CDS 84..314 /gene="LOC108061005" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_017002464.2" /db_xref="GeneID:108061005" /translation="MTSRILILSLSLLLLGIPHPTTALPQDVASGVMLAIGQAQQLFE PEGGWKPPVSEEYFGEQYESGSIGDLPTGRRR" polyA_site 411 /gene="LOC108061005" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 aatagaaagc cactaaaaac cagagcttaa atagctgact tgctggttgc tcggcagtta 61 tttgccagtg gagccaacac aagatgacat cgagaatttt gatcctgagt ttgagtctcc 121 ttctcttagg cattccccac cccaccaccg cgttgcccca ggatgtcgcc tctggcgtga 181 tgctggccat tggtcaggcg cagcagctgt tcgaacccga aggcggctgg aagccacctg 241 tgagtgagga gtacttcggc gagcaatacg aaagcggtag tattggcgat ttgcccacgg 301 gacgcaggcg ctgaggggat agttattttc taactgattg taccagttcc agttgactgt 361 gatttaatgt gaacgcaact tgattaaaaa gaaattcggt cgttgtgtaa a