Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017146975             411 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108061005), mRNA.
ACCESSION   XM_017146975
VERSION     XM_017146975.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017146975.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..411
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..411
                     /gene="LOC108061005"
                     /note="uncharacterized LOC108061005; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:108061005"
     CDS             84..314
                     /gene="LOC108061005"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_017002464.2"
                     /db_xref="GeneID:108061005"
                     /translation="MTSRILILSLSLLLLGIPHPTTALPQDVASGVMLAIGQAQQLFE
                     PEGGWKPPVSEEYFGEQYESGSIGDLPTGRRR"
     polyA_site      411
                     /gene="LOC108061005"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aatagaaagc cactaaaaac cagagcttaa atagctgact tgctggttgc tcggcagtta
       61 tttgccagtg gagccaacac aagatgacat cgagaatttt gatcctgagt ttgagtctcc
      121 ttctcttagg cattccccac cccaccaccg cgttgcccca ggatgtcgcc tctggcgtga
      181 tgctggccat tggtcaggcg cagcagctgt tcgaacccga aggcggctgg aagccacctg
      241 tgagtgagga gtacttcggc gagcaatacg aaagcggtag tattggcgat ttgcccacgg
      301 gacgcaggcg ctgaggggat agttattttc taactgattg taccagttcc agttgactgt
      361 gatttaatgt gaacgcaact tgattaaaaa gaaattcggt cgttgtgtaa a