Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017146971 1279 bp mRNA linear INV 09-DEC-2024 (LOC108061003), transcript variant X2, mRNA. ACCESSION XM_017146971 VERSION XM_017146971.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017146971.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1279 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1279 /gene="LOC108061003" /note="uncharacterized LOC108061003; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108061003" CDS 104..1126 /gene="LOC108061003" /codon_start=1 /product="uncharacterized protein isoform X2" /protein_id="XP_017002460.1" /db_xref="GeneID:108061003" /translation="MFAVALTMAALLLAGQQEVCRAQVSIHTDANTNSYSLKTPGVQQ TFTRFYGGAARTPQQVEQPQPQQQQQVEQQQQQQEQEQLQNPAQFGGFSPSGQQYPAV YAQPGLRGGGKLKATPISLLQQQQQQLLAQQQQQLLAATAQQQQQQQGSGLGSGSGAA GGGVVNMPSYADQMHAAFLDYQRQRAEFEQQQQQLLQKLYHYYPDVSGGLPSGAQAQS PPADGGAVGVAPPAANRFVYRRPQFAGGAPGSAAGPLRTNGAGDFYSTQQHMGFMQQQ QQDVLRDQQQSVAQQFATSQLAPTTRQSYGMAVPMSSVLGSPSYQQSPDVSHVSFSSG NLNYSF" polyA_site 1279 /gene="LOC108061003" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 accaacgacg ttcgcgattc gcgttaactt ggccaaaccg atccacggtt cctaagttcc 61 tcagttccaa agactcagcg ggatatcttt acccacgtaa atcatgtttg cagtggcctt 121 gacaatggcg gccttgcttc tggccggcca gcaggaggtg tgccgggcgc aggtgtccat 181 ccacacggac gcaaacacga attcctatag cctcaagaca ccgggagtgc agcagacctt 241 cactcgattc tacggcggag cagcaaggac gccgcagcag gtggagcagc ctcagcctca 301 gcagcagcag caggtggagc agcagcagca gcagcaggag caggagcaac tgcaaaatcc 361 cgcccaattt ggtggcttct cgccatcggg acaacagtat ccggccgtct acgcgcagcc 421 gggactccgg ggcggtggca agctcaaggc cacgcccatc tccctgctgc agcagcagca 481 acagcagttg ttggctcagc agcagcagca gctgttggcc gccacagcgc agcagcagca 541 gcagcagcag ggatctggat taggatcggg ttcaggggcg gcgggcggtg gcgtggtcaa 601 tatgcccagc tatgcggacc aaatgcacgc cgccttcctc gactatcagc gccagcgggc 661 ggaattcgag cagcaacagc agcagctgct gcagaagctc tatcactact atcccgatgt 721 ttccggcggc ctcccctctg gcgcccaagc tcagtcgccg cccgccgacg gaggagcagt 781 gggcgtggca ccgccagcag ccaaccgctt cgtctaccgt cgtccgcagt tcgccggcgg 841 cgctccagga tcagcagcag gacctctacg caccaacgga gccggcgact tctactccac 901 gcagcagcac atgggcttca tgcagcagca gcagcaggat gtgctacgcg accagcagca 961 gtcggtggcc cagcagttcg ccaccagcca gctggcgccc accacccgcc agagctacgg 1021 gatggccgtt cccatgtcct cggtgctggg ctccccgtcc taccaacagt cgccggacgt 1081 ctcgcatgtc agcttctcga gcggcaacct caactacagc ttctgagctt ctgggaagcg 1141 gatttcggac taactgctag tatttcccat atattatttt cgagaatcta agtttttttt 1201 tttgcgtaaa ttttcgtggt atttgataag aggaattgtg tagggcaagc aagaataaat 1261 tttgtgagtg atgataatg