Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017146971            1279 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108061003), transcript variant X2, mRNA.
ACCESSION   XM_017146971
VERSION     XM_017146971.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017146971.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1279
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1279
                     /gene="LOC108061003"
                     /note="uncharacterized LOC108061003; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108061003"
     CDS             104..1126
                     /gene="LOC108061003"
                     /codon_start=1
                     /product="uncharacterized protein isoform X2"
                     /protein_id="XP_017002460.1"
                     /db_xref="GeneID:108061003"
                     /translation="MFAVALTMAALLLAGQQEVCRAQVSIHTDANTNSYSLKTPGVQQ
                     TFTRFYGGAARTPQQVEQPQPQQQQQVEQQQQQQEQEQLQNPAQFGGFSPSGQQYPAV
                     YAQPGLRGGGKLKATPISLLQQQQQQLLAQQQQQLLAATAQQQQQQQGSGLGSGSGAA
                     GGGVVNMPSYADQMHAAFLDYQRQRAEFEQQQQQLLQKLYHYYPDVSGGLPSGAQAQS
                     PPADGGAVGVAPPAANRFVYRRPQFAGGAPGSAAGPLRTNGAGDFYSTQQHMGFMQQQ
                     QQDVLRDQQQSVAQQFATSQLAPTTRQSYGMAVPMSSVLGSPSYQQSPDVSHVSFSSG
                     NLNYSF"
     polyA_site      1279
                     /gene="LOC108061003"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 accaacgacg ttcgcgattc gcgttaactt ggccaaaccg atccacggtt cctaagttcc
       61 tcagttccaa agactcagcg ggatatcttt acccacgtaa atcatgtttg cagtggcctt
      121 gacaatggcg gccttgcttc tggccggcca gcaggaggtg tgccgggcgc aggtgtccat
      181 ccacacggac gcaaacacga attcctatag cctcaagaca ccgggagtgc agcagacctt
      241 cactcgattc tacggcggag cagcaaggac gccgcagcag gtggagcagc ctcagcctca
      301 gcagcagcag caggtggagc agcagcagca gcagcaggag caggagcaac tgcaaaatcc
      361 cgcccaattt ggtggcttct cgccatcggg acaacagtat ccggccgtct acgcgcagcc
      421 gggactccgg ggcggtggca agctcaaggc cacgcccatc tccctgctgc agcagcagca
      481 acagcagttg ttggctcagc agcagcagca gctgttggcc gccacagcgc agcagcagca
      541 gcagcagcag ggatctggat taggatcggg ttcaggggcg gcgggcggtg gcgtggtcaa
      601 tatgcccagc tatgcggacc aaatgcacgc cgccttcctc gactatcagc gccagcgggc
      661 ggaattcgag cagcaacagc agcagctgct gcagaagctc tatcactact atcccgatgt
      721 ttccggcggc ctcccctctg gcgcccaagc tcagtcgccg cccgccgacg gaggagcagt
      781 gggcgtggca ccgccagcag ccaaccgctt cgtctaccgt cgtccgcagt tcgccggcgg
      841 cgctccagga tcagcagcag gacctctacg caccaacgga gccggcgact tctactccac
      901 gcagcagcac atgggcttca tgcagcagca gcagcaggat gtgctacgcg accagcagca
      961 gtcggtggcc cagcagttcg ccaccagcca gctggcgccc accacccgcc agagctacgg
     1021 gatggccgtt cccatgtcct cggtgctggg ctccccgtcc taccaacagt cgccggacgt
     1081 ctcgcatgtc agcttctcga gcggcaacct caactacagc ttctgagctt ctgggaagcg
     1141 gatttcggac taactgctag tatttcccat atattatttt cgagaatcta agtttttttt
     1201 tttgcgtaaa ttttcgtggt atttgataag aggaattgtg tagggcaagc aagaataaat
     1261 tttgtgagtg atgataatg