Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017146930 570 bp mRNA linear INV 09-DEC-2024 (LOC108060978), transcript variant X2, mRNA. ACCESSION XM_017146930 VERSION XM_017146930.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017146930.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..570 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..570 /gene="LOC108060978" /note="cuticle protein 21.3; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108060978" CDS 1..447 /gene="LOC108060978" /codon_start=1 /product="cuticle protein 21.3 isoform X2" /protein_id="XP_017002419.1" /db_xref="GeneID:108060978" /translation="MAFKVVLCVLALIACASAKPGGPAAYSISAPSVDHASVGSTQEH TVKGHYGQSSQSDYASQVQTAHSQSHVQRSSISNDAGLAPVAAHGYAAPGIIGHGIGL AAPAYAAPAYAAPAYATHLAGPVVKAVAAPALVHTQVSGHGIHYGY" ORIGIN 1 atggcattca aggttgtact ctgtgtcctg gcgttgatcg cctgtgccag cgcaaagccc 61 ggcggcccgg cggcctactc gatcagcgct cccagcgtgg accacgcctc cgtcggcagc 121 acccaggagc acacggtgaa gggccactac ggccagtcct cccagtcgga ctacgccagc 181 caggtccaga cggcccactc gcagtcgcat gtccagcgat cgagcatcag caatgacgcc 241 ggcctggcgc ccgttgccgc ccacggttac gcagctcccg gaatcattgg acacggcatc 301 ggactggccg cccccgcata cgcagccccc gcctacgctg cccctgccta cgccacgcac 361 ctggccgggc ccgtggtgaa ggccgtcgcc gcacccgccc tcgtccacac acaggtctcc 421 ggtcatggca ttcactatgg ctactagggg atccagatcc agatccagta aaccaccccg 481 tccagtaccc agaaaaccag ccacccatcc acctagccgc catccgtctg gctaacaaca 541 ctaataggaa caataatacc cagagcgtgt