Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii cuticle protein 21.3


LOCUS       XM_017146930             570 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108060978), transcript variant X2, mRNA.
ACCESSION   XM_017146930
VERSION     XM_017146930.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017146930.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..570
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..570
                     /gene="LOC108060978"
                     /note="cuticle protein 21.3; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108060978"
     CDS             1..447
                     /gene="LOC108060978"
                     /codon_start=1
                     /product="cuticle protein 21.3 isoform X2"
                     /protein_id="XP_017002419.1"
                     /db_xref="GeneID:108060978"
                     /translation="MAFKVVLCVLALIACASAKPGGPAAYSISAPSVDHASVGSTQEH
                     TVKGHYGQSSQSDYASQVQTAHSQSHVQRSSISNDAGLAPVAAHGYAAPGIIGHGIGL
                     AAPAYAAPAYAAPAYATHLAGPVVKAVAAPALVHTQVSGHGIHYGY"
ORIGIN      
        1 atggcattca aggttgtact ctgtgtcctg gcgttgatcg cctgtgccag cgcaaagccc
       61 ggcggcccgg cggcctactc gatcagcgct cccagcgtgg accacgcctc cgtcggcagc
      121 acccaggagc acacggtgaa gggccactac ggccagtcct cccagtcgga ctacgccagc
      181 caggtccaga cggcccactc gcagtcgcat gtccagcgat cgagcatcag caatgacgcc
      241 ggcctggcgc ccgttgccgc ccacggttac gcagctcccg gaatcattgg acacggcatc
      301 ggactggccg cccccgcata cgcagccccc gcctacgctg cccctgccta cgccacgcac
      361 ctggccgggc ccgtggtgaa ggccgtcgcc gcacccgccc tcgtccacac acaggtctcc
      421 ggtcatggca ttcactatgg ctactagggg atccagatcc agatccagta aaccaccccg
      481 tccagtaccc agaaaaccag ccacccatcc acctagccgc catccgtctg gctaacaaca
      541 ctaataggaa caataatacc cagagcgtgt