Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017146925 800 bp mRNA linear INV 09-DEC-2024 (LOC108060973), mRNA. ACCESSION XM_017146925 VERSION XM_017146925.2 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Oct 18, 2021 this sequence version replaced XM_017146925.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..800 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..800 /gene="LOC108060973" /note="uncharacterized LOC108060973; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108060973" CDS 67..546 /gene="LOC108060973" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_017002414.1" /db_xref="GeneID:108060973" /translation="MICDLVICCLVLGLAISASGQPHARASDLYYTDITPVTDDTRYT TLNPDIQLTEMNKVKHSKGNIVFTSGERTSGDRLIVNHYDDESFASAKDIEVLMSYPA GSTTGVTLTCIEVYVDQSADDAGGYLSKGGIGQTNVEILLTSNLTRSFVYETFIYGY" misc_feature 274..540 /gene="LOC108060973" /note="Transcription activator MBF2; Region: MBF2; pfam15868" /db_xref="CDD:464913" polyA_site 800 /gene="LOC108060973" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gcggttgaat agtgcattag aaagagccca gaaccctcct tatatttttt ttcggtgttt 61 cgcgaaatga tctgtgatct tgtgatctgt tgcctggttt tgggcctagc catttcggca 121 tccggacagc cacatgcccg tgccagcgat ctttactata cggacatcac cccggtgacc 181 gatgacacgc gatacaccac actcaatccg gatatccagc tcaccgagat gaacaaggtg 241 aagcactcga agggcaacat cgtctttacc tccggggagc gaacgtcggg cgatcggctg 301 attgtgaatc actacgatga cgagagcttc gccagcgcaa aggacatcga ggtgctgatg 361 agctatccgg ccggatcgac aaccggagtc acgctcacct gcatcgaggt gtacgtggac 421 cagtcggcgg acgatgccgg cggctatctg agcaaaggcg gcatcggtca gaccaacgtc 481 gagatcctgc tcacctccaa tctgacccgc agcttcgtct acgagacgtt catctacggc 541 tactaggaac tccgcgtcgc ccagaacttt cagctacaat aaaagtttcg cctggaaccc 601 aactgtgatc atgaacttaa aacccttccc ctgtttctgc ccttcctgcc gagagtatta 661 ttagtattat agacctacat taaagaacat aggaaaaaaa atccaaacac actcctgtga 721 aaatccacac acaatgtttt ttactcatcc aaatcgttgt acaaataaag tgttccttgt 781 tggttggcgc cctatcgaaa