Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017146925             800 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108060973), mRNA.
ACCESSION   XM_017146925
VERSION     XM_017146925.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 18, 2021 this sequence version replaced XM_017146925.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..800
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..800
                     /gene="LOC108060973"
                     /note="uncharacterized LOC108060973; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108060973"
     CDS             67..546
                     /gene="LOC108060973"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_017002414.1"
                     /db_xref="GeneID:108060973"
                     /translation="MICDLVICCLVLGLAISASGQPHARASDLYYTDITPVTDDTRYT
                     TLNPDIQLTEMNKVKHSKGNIVFTSGERTSGDRLIVNHYDDESFASAKDIEVLMSYPA
                     GSTTGVTLTCIEVYVDQSADDAGGYLSKGGIGQTNVEILLTSNLTRSFVYETFIYGY"
     misc_feature    274..540
                     /gene="LOC108060973"
                     /note="Transcription activator MBF2; Region: MBF2;
                     pfam15868"
                     /db_xref="CDD:464913"
     polyA_site      800
                     /gene="LOC108060973"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gcggttgaat agtgcattag aaagagccca gaaccctcct tatatttttt ttcggtgttt
       61 cgcgaaatga tctgtgatct tgtgatctgt tgcctggttt tgggcctagc catttcggca
      121 tccggacagc cacatgcccg tgccagcgat ctttactata cggacatcac cccggtgacc
      181 gatgacacgc gatacaccac actcaatccg gatatccagc tcaccgagat gaacaaggtg
      241 aagcactcga agggcaacat cgtctttacc tccggggagc gaacgtcggg cgatcggctg
      301 attgtgaatc actacgatga cgagagcttc gccagcgcaa aggacatcga ggtgctgatg
      361 agctatccgg ccggatcgac aaccggagtc acgctcacct gcatcgaggt gtacgtggac
      421 cagtcggcgg acgatgccgg cggctatctg agcaaaggcg gcatcggtca gaccaacgtc
      481 gagatcctgc tcacctccaa tctgacccgc agcttcgtct acgagacgtt catctacggc
      541 tactaggaac tccgcgtcgc ccagaacttt cagctacaat aaaagtttcg cctggaaccc
      601 aactgtgatc atgaacttaa aacccttccc ctgtttctgc ccttcctgcc gagagtatta
      661 ttagtattat agacctacat taaagaacat aggaaaaaaa atccaaacac actcctgtga
      721 aaatccacac acaatgtttt ttactcatcc aaatcgttgt acaaataaag tgttccttgt
      781 tggttggcgc cctatcgaaa