Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017146907 740 bp mRNA linear INV 09-DEC-2024 ACCESSION XM_017146907 VERSION XM_017146907.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017146907.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..740 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..740 /gene="Hesr" /note="HES-related; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:108060958" CDS 10..585 /gene="Hesr" /codon_start=1 /product="enhancer of split m3 protein" /protein_id="XP_017002396.2" /db_xref="GeneID:108060958" /translation="MGAYQSWRCCSTSLFAIQSLEIRRTSWARLTMSSPKEQEKEQEK EQEPEKSHGPKAGAMSRTHQYRKVMKPLLERKRRARINRSVEDLKNLLKEITQMDAET LAKMEKADILELTVHHLHRQLGNSPATPIITASASRTEHMAMERYWSGFRQCALEVSR FLQQNNFDLNERFVEEMEQLVPAEAFLWRPW" misc_feature 184..375 /gene="Hesr" /note="basic helix-loop-helix-orange (bHLH-O) domain found in Drosophila melanogaster enhancer of split mbeta protein (ESMB) and similar proteins; Region: bHLH-O_ESMB_like; cd19741" /db_xref="CDD:381584" misc_feature order(217..219,238..243,247..255,259..264,268..273, 280..285,292..294,322..324,328..336,343..348,352..357, 361..369,373..375) /gene="Hesr" /note="putative dimer interface [polypeptide binding]; other site" /db_xref="CDD:381584" misc_feature order(217..225,232..234,238..243,253..255,328..333) /gene="Hesr" /note="putative DNA binding site [nucleotide binding]; other site" /db_xref="CDD:381584" misc_feature 445..>495 /gene="Hesr" /note="Hairy Orange; Region: Hairy_orange; cl02638" /db_xref="CDD:470640" ORIGIN 1 actccgctaa tgggcgcata tcaaagctgg cgctgctgct ccacttcgct gtttgccatt 61 cagtcgctcg agattcggag gacgagttgg gccaggctta cgatgtcgag tcccaaggag 121 caggagaagg agcaggagaa ggagcaggag ccggagaagt cccatggacc gaaggcgggg 181 gccatgtcca ggacgcatca gtatcgcaag gtgatgaagc cactgctgga gaggaagagg 241 cgggcgagga ttaaccgcag tgtggaggat ctgaagaatc ttcttaaaga gataacccaa 301 atggacgccg agacattggc caaaatggag aaggccgaca ttctggagct gaccgtccat 361 catctgcaca ggcaactcgg caattctccg gccacgccca tcatcaccgc ctccgcctcc 421 cgaaccgagc atatggcaat ggagcgctac tggagcggct ttcgacagtg cgccctcgaa 481 gtctcgcgat tcctgcaaca gaacaacttt gacctcaacg aaagattcgt tgaggaaatg 541 gagcagctgg tgcccgccga ggccttcctc tggcgccctt ggtagctata gtaggggggt 601 ttccaaaaaa aaaacgatcc ctacctcacc attttaaaat ggacctaacc gtattattgc 661 tctgggttag ctgaatgtgt aaaaagttta gcaatagctt cataccctca tcattcactt 721 ttattatgtg taaaaaaaaa