Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii HES-related (Hesr), mRNA.


LOCUS       XM_017146907             740 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017146907
VERSION     XM_017146907.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017146907.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..740
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..740
                     /gene="Hesr"
                     /note="HES-related; Derived by automated computational
                     analysis using gene prediction method: Gnomon."
                     /db_xref="GeneID:108060958"
     CDS             10..585
                     /gene="Hesr"
                     /codon_start=1
                     /product="enhancer of split m3 protein"
                     /protein_id="XP_017002396.2"
                     /db_xref="GeneID:108060958"
                     /translation="MGAYQSWRCCSTSLFAIQSLEIRRTSWARLTMSSPKEQEKEQEK
                     EQEPEKSHGPKAGAMSRTHQYRKVMKPLLERKRRARINRSVEDLKNLLKEITQMDAET
                     LAKMEKADILELTVHHLHRQLGNSPATPIITASASRTEHMAMERYWSGFRQCALEVSR
                     FLQQNNFDLNERFVEEMEQLVPAEAFLWRPW"
     misc_feature    184..375
                     /gene="Hesr"
                     /note="basic helix-loop-helix-orange (bHLH-O) domain found
                     in Drosophila melanogaster enhancer of split mbeta protein
                     (ESMB) and similar proteins; Region: bHLH-O_ESMB_like;
                     cd19741"
                     /db_xref="CDD:381584"
     misc_feature    order(217..219,238..243,247..255,259..264,268..273,
                     280..285,292..294,322..324,328..336,343..348,352..357,
                     361..369,373..375)
                     /gene="Hesr"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:381584"
     misc_feature    order(217..225,232..234,238..243,253..255,328..333)
                     /gene="Hesr"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:381584"
     misc_feature    445..>495
                     /gene="Hesr"
                     /note="Hairy Orange; Region: Hairy_orange; cl02638"
                     /db_xref="CDD:470640"
ORIGIN      
        1 actccgctaa tgggcgcata tcaaagctgg cgctgctgct ccacttcgct gtttgccatt
       61 cagtcgctcg agattcggag gacgagttgg gccaggctta cgatgtcgag tcccaaggag
      121 caggagaagg agcaggagaa ggagcaggag ccggagaagt cccatggacc gaaggcgggg
      181 gccatgtcca ggacgcatca gtatcgcaag gtgatgaagc cactgctgga gaggaagagg
      241 cgggcgagga ttaaccgcag tgtggaggat ctgaagaatc ttcttaaaga gataacccaa
      301 atggacgccg agacattggc caaaatggag aaggccgaca ttctggagct gaccgtccat
      361 catctgcaca ggcaactcgg caattctccg gccacgccca tcatcaccgc ctccgcctcc
      421 cgaaccgagc atatggcaat ggagcgctac tggagcggct ttcgacagtg cgccctcgaa
      481 gtctcgcgat tcctgcaaca gaacaacttt gacctcaacg aaagattcgt tgaggaaatg
      541 gagcagctgg tgcccgccga ggccttcctc tggcgccctt ggtagctata gtaggggggt
      601 ttccaaaaaa aaaacgatcc ctacctcacc attttaaaat ggacctaacc gtattattgc
      661 tctgggttag ctgaatgtgt aaaaagttta gcaatagctt cataccctca tcattcactt
      721 ttattatgtg taaaaaaaaa