Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017146889 1109 bp mRNA linear INV 09-DEC-2024 D4-like (LOC108060940), mRNA. ACCESSION XM_017146889 VERSION XM_017146889.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017146889.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1109 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1109 /gene="LOC108060940" /note="ubiquitin-conjugating enzyme E2 D4-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108060940" CDS 255..971 /gene="LOC108060940" /codon_start=1 /product="ubiquitin-conjugating enzyme E2 D4-like" /protein_id="XP_017002378.1" /db_xref="GeneID:108060940" /translation="MMGHRLPYVDMDMGDRGDGVQLNGTENRHRRWLERRHRMRDRLR EREQERNRERNRDMEWSLEIIKPPNEQSGRLAAAAKNAIPAVLRLVKELQVMETDPPE NTWARPKSMSNLLRWRAKIRGPEGSPYEGGVFELALSFPEAYPFEAPIVRFITPLYHC NVNGLGYICVDILDEQQCWSPGLTVDKLLLSLSALLYDADPLTAYNAEAAGQFLQDRE RYDRIARSWTERHAMDVPWD" misc_feature 516..944 /gene="LOC108060940" /note="Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain/ubiquitin E2 variant (UEV) domain; Region: UBCc_UEV; cl49610" /db_xref="CDD:483950" polyA_site 1109 /gene="LOC108060940" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gcagcgaggg gtgagtgagg gaagagtgcc cattcagttc agtttcagtc ggttgtaatg 61 aatgttagga acctgtaaat cctgtattct aaattattgt attcgtaaac ggcaaaagcc 121 aagataaatt gccctctgca tgtgattaac ccactggcgg ccattggcga ccaccgacgg 181 actaccagag aaacgaagca ggaactcaag aagggattca gtggaatcag ttgaatcagt 241 tgaaacaagg gatcatgatg ggccaccgtc taccgtatgt ggacatggac atgggcgatc 301 gcggcgacgg cgtccagctg aacggaaccg agaacagaca caggcgctgg ctggagaggc 361 gccacaggat gcgggatcgg ttgagggagc gggagcagga gcggaaccgg gagcggaacc 421 gggacatgga gtggagcctg gagatcatca agcctccgaa cgagcagtcc ggacgtctgg 481 cagccgcggc caagaatgcc attccggcgg tacttcgtct tgtcaaggaa ctccaggtaa 541 tggagaccga tccgccggag aacacgtggg cgcgtcccaa gtcgatgagc aacctgctcc 601 ggtggcgggc caagatccgc ggacccgagg gcagtcccta cgagggcggg gtcttcgagc 661 tggccctgag cttcccggag gcctatccct tcgaggcgcc catcgtgcgc ttcatcacgc 721 cgctctacca ctgcaacgtg aacggactgg gctacatctg cgtggacatc ctggacgagc 781 agcagtgctg gtcgccgggc ctcacggtgg acaagctgct gctgtcgctg tcggcgctcc 841 tgtacgacgc cgatccgctg accgcctaca acgcggaggc cgccggccag ttcctgcagg 901 accgcgagcg gtacgaccgc atcgcccgct cctggaccga gcggcatgcc atggacgtgc 961 cctgggattg agtggtggtc ggcacttccg gcttaagttc cgtagtcctt cgatgggtcg 1021 agcgtggtgc tggcatagtt attttggact tggtttcgat tgtgatgcag attgaatttt 1081 ggaataaaca cgatggtgtg tcctctgta