Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii mitochondrial ribosomal protein


LOCUS       XM_017146885             372 bp    mRNA    linear   INV 09-DEC-2024
            L33 (mRpL33), mRNA.
ACCESSION   XM_017146885
VERSION     XM_017146885.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017146885.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..372
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..372
                     /gene="mRpL33"
                     /note="mitochondrial ribosomal protein L33; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:108060937"
     CDS             99..293
                     /gene="mRpL33"
                     /codon_start=1
                     /product="large ribosomal subunit protein bL33m"
                     /protein_id="XP_017002374.1"
                     /db_xref="GeneID:108060937"
                     /translation="MRLTNVLFKKVKSKRIMVVLESVVSGHQYNAFRDRLADKLEIIR
                     FDPYIQQESLYRERKKIRSA"
     polyA_site      372
                     /gene="mRpL33"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ggggtcagct gtttcacgtg cctatcgttt tgcttgcaca acaattttgc ggcgtttttc
       61 cagaatttaa ggaattttcc ccattttact gaaacaaaat gcgtctgacg aatgttttgt
      121 tcaagaaagt gaagagcaag cgaattatgg tggtgctgga aagtgtggtc agcggacatc
      181 aatataatgc ctttcgcgat cgtttggccg acaaattgga gataatacgc ttcgacccgt
      241 acattcaaca ggagagtctc tatcgcgaac gcaagaaaat ccgcagcgcc taaggaaatc
      301 ccactaaatg tcctgatttt cccagtttaa gttagtgcaa ataaaataca aaatcaaatc
      361 agttaaacaa aa