Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017146871 529 bp mRNA linear INV 09-DEC-2024 ACCESSION XM_017146871 VERSION XM_017146871.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017146871.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..529 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..529 /gene="ssp7" /note="short spindle 7; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108060925" CDS 94..360 /gene="ssp7" /codon_start=1 /product="uncharacterized protein ssp7" /protein_id="XP_017002360.1" /db_xref="GeneID:108060925" /translation="MKSVTFVLCLVVLGAHSLLVFGADCEISGHKLKTGEKYSPVGRC LQYTCQGPKSLSALTCPSVATLKPCKMEEDLTKPYPGCCPKFNC" misc_feature 175..357 /gene="ssp7" /note="Single domain von Willebrand factor type C; Region: SVWC; pfam15430" /db_xref="CDD:464713" polyA_site 529 /gene="ssp7" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tcttgacctt tcaatctaat cgcaggcgca ccccaaacaa ataactatat agtcgggcag 61 ctgagcgatc tcgggatcag ttggctgaaa aatatgaagt cggttacgtt cgtactctgc 121 ctggtcgttc tgggcgccca ctcgctgctc gtttttgggg ccgactgcga gatcagcggt 181 cataaactga agactgggga gaaatatagt ccggtaggtc gctgtctgca gtacacctgc 241 cagggaccca agtcgctttc ggcactgaca tgcccttctg tggccacgct gaagccctgc 301 aaaatggagg aggacctgac caagccttat cccggctgct gtccaaagtt taactgctag 361 taacataaca aatcgacctg caagtgaata aaaaaaaatt taaaaactac aaattaaatt 421 ccgaacatct taaaataaaa catagaagca aaacttaaaa tcttaacatt tttaaattta 481 taattagtaa accgaaaata atagtgcacc tcgcttacaa aaaccaaaa