Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii short spindle 7 (ssp7), mRNA.


LOCUS       XM_017146871             529 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017146871
VERSION     XM_017146871.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017146871.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..529
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..529
                     /gene="ssp7"
                     /note="short spindle 7; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 1 Protein"
                     /db_xref="GeneID:108060925"
     CDS             94..360
                     /gene="ssp7"
                     /codon_start=1
                     /product="uncharacterized protein ssp7"
                     /protein_id="XP_017002360.1"
                     /db_xref="GeneID:108060925"
                     /translation="MKSVTFVLCLVVLGAHSLLVFGADCEISGHKLKTGEKYSPVGRC
                     LQYTCQGPKSLSALTCPSVATLKPCKMEEDLTKPYPGCCPKFNC"
     misc_feature    175..357
                     /gene="ssp7"
                     /note="Single domain von Willebrand factor type C; Region:
                     SVWC; pfam15430"
                     /db_xref="CDD:464713"
     polyA_site      529
                     /gene="ssp7"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tcttgacctt tcaatctaat cgcaggcgca ccccaaacaa ataactatat agtcgggcag
       61 ctgagcgatc tcgggatcag ttggctgaaa aatatgaagt cggttacgtt cgtactctgc
      121 ctggtcgttc tgggcgccca ctcgctgctc gtttttgggg ccgactgcga gatcagcggt
      181 cataaactga agactgggga gaaatatagt ccggtaggtc gctgtctgca gtacacctgc
      241 cagggaccca agtcgctttc ggcactgaca tgcccttctg tggccacgct gaagccctgc
      301 aaaatggagg aggacctgac caagccttat cccggctgct gtccaaagtt taactgctag
      361 taacataaca aatcgacctg caagtgaata aaaaaaaatt taaaaactac aaattaaatt
      421 ccgaacatct taaaataaaa catagaagca aaacttaaaa tcttaacatt tttaaattta
      481 taattagtaa accgaaaata atagtgcacc tcgcttacaa aaaccaaaa