Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017146870 1100 bp mRNA linear INV 09-DEC-2024 (LOC108060923), mRNA. ACCESSION XM_017146870 VERSION XM_017146870.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017146870.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1100 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1100 /gene="LOC108060923" /note="uncharacterized LOC108060923; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108060923" CDS 478..825 /gene="LOC108060923" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_017002359.1" /db_xref="GeneID:108060923" /translation="MRIEVGCLLVLLSICGAARADLTYRGNAVHPDFPGQCYYEELNQ AIPKKQSYKPINREGYCQSIYCRPDYVLEIGYCGRHNLVPTEQCKIASDMRRTFPDCC PKLVCQEAESNYI" misc_feature 586..798 /gene="LOC108060923" /note="Single domain von Willebrand factor type C; Region: SVWC; pfam15430" /db_xref="CDD:464713" polyA_site 1100 /gene="LOC108060923" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 agtgtatgtg gccgaaattc ggctttacaa aagagttatt tgcgtgtttt gattactttt 61 cgcgacgcag caaccttgcc acagtttctc gaaccgtgtc acttaactgt caggaacccc 121 ccaccaccac tcccattccc gcccagcccc atccgatccc cgccagatat gtatcactct 181 cgctttcagg gctggcttaa ttaatttaaa tttaaactag agctagagcg gacgccttaa 241 gtcgtcgtca aacaaaaggc acagatacag atgatatctg ggtatgtgct atatctcagt 301 atgtatgcat acatacaatg tacggcacaa tgtttattat taattttata taaaagcaac 361 aacaattaat tgtaattgac tcagtcgcac gggtagcgca caacagccaa gtcggatttg 421 gatttgcatt ggtcttcgga atctctaact taatttccat tattttactt ggcgattatg 481 cgcatcgaag ttggttgtct tctggtgctc ctgagcattt gtggtgcagc acgagcggat 541 ctcacctatc gcggaaatgc ggttcaccca gattttcccg gccagtgtta ctatgaggaa 601 ctcaaccagg ccattcccaa gaagcagtca tacaagccaa tcaatcgcga gggctattgc 661 caatcgatct actgtcggcc ggattatgtc ctagaaattg gctattgcgg tcgccacaac 721 ctggtgccga cggaacaatg caagatcgcg tcggacatga gacgcacctt ccccgactgc 781 tgtcccaagt tggtttgcca ggaggcggag agcaactaca tctaggctgg atccggatgc 841 tatgtaaatt cagcacttag tattacttcg tttggaataa cgatttcaaa attactggat 901 taatttttct tataagatgg atattttaat aacctcatgg ctggtcaaaa attgttatca 961 atttccgttt caggaatcca gtgcaactat ttataaggct cttttatgtt tttaatattc 1021 tggcggaaag tgtgtcgata taaacaggac aactacaaaa cttaataata aatttatatt 1081 tgttaatatt aactaaaaaa