Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Autophagy-related 8a (Atg8a),


LOCUS       XM_017146835            1097 bp    mRNA    linear   INV 09-DEC-2024
            mRNA.
ACCESSION   XM_017146835
VERSION     XM_017146835.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017146835.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1097
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1097
                     /gene="Atg8a"
                     /note="Autophagy-related 8a; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 13
                     Proteins"
                     /db_xref="GeneID:108060902"
     CDS             161..526
                     /gene="Atg8a"
                     /codon_start=1
                     /product="gamma-aminobutyric acid receptor-associated
                     protein"
                     /protein_id="XP_017002324.1"
                     /db_xref="GeneID:108060902"
                     /translation="MKFQYKEEHAFEKRRAEGDKIRRKYPDRVPVIVEKAPKARIGDL
                     DKKKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHEED
                     YFLYIAYSDENVYGMARVN"
     misc_feature    164..508
                     /gene="Atg8a"
                     /note="ubiquitin-like (Ubl) domain found in
                     gamma-aminobutyric acid receptor-associated protein
                     (GABARAP); Region: Ubl_ATG8_GABARAP; cd17232"
                     /db_xref="CDD:340752"
     misc_feature    order(173..175,185..187,209..211,221..223,233..235,
                     242..244,248..256,290..310,314..316,347..349,470..472)
                     /gene="Atg8a"
                     /note="peptide binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:340752"
     misc_feature    order(242..244,260..265,296..298,305..307,332..337,
                     341..349,353..361,374..379,383..391,395..397,404..412,
                     416..424,494..508)
                     /gene="Atg8a"
                     /note="Atg7 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:340752"
     misc_feature    order(266..268,341..343,353..355,374..391,395..397,
                     404..421,482..484,488..508)
                     /gene="Atg8a"
                     /note="Atg4 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:340752"
     polyA_site      1097
                     /gene="Atg8a"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ctagacttca gtttcagccc gttaggtcga aagcgcagag caaaaaaaaa cacaaccaca
       61 gcgaagacgc acacacacat acgtcgcatc gatatttcct tcgagaagaa aagcgaaccg
      121 aacgctgcgt ttcctagcca attacctgtt aaccacaatc atgaagttcc aatacaagga
      181 ggagcacgcc ttcgagaagc gtcgcgccga gggcgacaag atccgtcgca aatatccaga
      241 ccgtgtgccc gtgatcgtcg agaaggctcc caaggcgcgc atcggtgact tggacaagaa
      301 gaagtacctg gtgccttccg acctgaccgt cggtcagttc tacttcctca ttcgcaagcg
      361 catccacctg cgtcccgagg atgccctctt cttctttgtg aacaacgtca ttccaccaac
      421 atcggcaacc atgggctccc tgtaccagga acaccacgag gaggactact tcctgtacat
      481 tgcctactcc gatgagaacg tctacggcat ggccagggtc aactaactct gctcccgttg
      541 gcggcggcgg aaaacaaccc cctataaaga aatctatata taaataaaat atattttgtg
      601 tttagcatgc aagcttaaaa tacggacgcg agttagctaa acgaattgag gaaaaccgca
      661 ggaaatgcca cgcgagaaaa gaacttgaaa gcgatctgaa ccagggcaac aaaaaaatcc
      721 acaaaacaga aaactacaaa aagaattgtt atgtgaacat tattttatat atatacattt
      781 tctaaacgcg ttagtatttg aattaaacct ctgctttgtc ctaccattaa cccccgaaaa
      841 aacagatcta ttcacacccc ttcggcccat ctaatttcca tttgctgtac ttgatccgtg
      901 cgattgcgac tgcgattgca attgcacttg taccttactt tgttcgctta tttcaatgat
      961 ttcacccttt tttttacaat acaacaagat gttgtgcata tttagtgtgt atggttacga
     1021 ataggactct ctcggttaag tgtacggtaa ttaatctatt attaaataaa caaaaaccac
     1081 aaaaatacac aagcaaa