Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017146835 1097 bp mRNA linear INV 09-DEC-2024 mRNA. ACCESSION XM_017146835 VERSION XM_017146835.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017146835.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1097 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1097 /gene="Atg8a" /note="Autophagy-related 8a; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 Proteins" /db_xref="GeneID:108060902" CDS 161..526 /gene="Atg8a" /codon_start=1 /product="gamma-aminobutyric acid receptor-associated protein" /protein_id="XP_017002324.1" /db_xref="GeneID:108060902" /translation="MKFQYKEEHAFEKRRAEGDKIRRKYPDRVPVIVEKAPKARIGDL DKKKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHEED YFLYIAYSDENVYGMARVN" misc_feature 164..508 /gene="Atg8a" /note="ubiquitin-like (Ubl) domain found in gamma-aminobutyric acid receptor-associated protein (GABARAP); Region: Ubl_ATG8_GABARAP; cd17232" /db_xref="CDD:340752" misc_feature order(173..175,185..187,209..211,221..223,233..235, 242..244,248..256,290..310,314..316,347..349,470..472) /gene="Atg8a" /note="peptide binding site [polypeptide binding]; other site" /db_xref="CDD:340752" misc_feature order(242..244,260..265,296..298,305..307,332..337, 341..349,353..361,374..379,383..391,395..397,404..412, 416..424,494..508) /gene="Atg8a" /note="Atg7 interaction site [polypeptide binding]; other site" /db_xref="CDD:340752" misc_feature order(266..268,341..343,353..355,374..391,395..397, 404..421,482..484,488..508) /gene="Atg8a" /note="Atg4 interaction site [polypeptide binding]; other site" /db_xref="CDD:340752" polyA_site 1097 /gene="Atg8a" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ctagacttca gtttcagccc gttaggtcga aagcgcagag caaaaaaaaa cacaaccaca 61 gcgaagacgc acacacacat acgtcgcatc gatatttcct tcgagaagaa aagcgaaccg 121 aacgctgcgt ttcctagcca attacctgtt aaccacaatc atgaagttcc aatacaagga 181 ggagcacgcc ttcgagaagc gtcgcgccga gggcgacaag atccgtcgca aatatccaga 241 ccgtgtgccc gtgatcgtcg agaaggctcc caaggcgcgc atcggtgact tggacaagaa 301 gaagtacctg gtgccttccg acctgaccgt cggtcagttc tacttcctca ttcgcaagcg 361 catccacctg cgtcccgagg atgccctctt cttctttgtg aacaacgtca ttccaccaac 421 atcggcaacc atgggctccc tgtaccagga acaccacgag gaggactact tcctgtacat 481 tgcctactcc gatgagaacg tctacggcat ggccagggtc aactaactct gctcccgttg 541 gcggcggcgg aaaacaaccc cctataaaga aatctatata taaataaaat atattttgtg 601 tttagcatgc aagcttaaaa tacggacgcg agttagctaa acgaattgag gaaaaccgca 661 ggaaatgcca cgcgagaaaa gaacttgaaa gcgatctgaa ccagggcaac aaaaaaatcc 721 acaaaacaga aaactacaaa aagaattgtt atgtgaacat tattttatat atatacattt 781 tctaaacgcg ttagtatttg aattaaacct ctgctttgtc ctaccattaa cccccgaaaa 841 aacagatcta ttcacacccc ttcggcccat ctaatttcca tttgctgtac ttgatccgtg 901 cgattgcgac tgcgattgca attgcacttg taccttactt tgttcgctta tttcaatgat 961 ttcacccttt tttttacaat acaacaagat gttgtgcata tttagtgtgt atggttacga 1021 ataggactct ctcggttaag tgtacggtaa ttaatctatt attaaataaa caaaaaccac 1081 aaaaatacac aagcaaa