Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii DNA replication complex GINS


LOCUS       XM_017146817            1213 bp    mRNA    linear   INV 09-DEC-2024
            protein Psf3 (Psf3), mRNA.
ACCESSION   XM_017146817
VERSION     XM_017146817.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017146817.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1213
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1213
                     /gene="Psf3"
                     /note="DNA replication complex GINS protein Psf3; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:108060892"
     CDS             155..784
                     /gene="Psf3"
                     /codon_start=1
                     /product="DNA replication complex GINS protein PSF3"
                     /protein_id="XP_017002306.2"
                     /db_xref="GeneID:108060892"
                     /translation="MNYFPNYYSIEDIFVTQEKVECRVNTKLQRMGFLDSGAESDDLE
                     PGRTVNLPLWYIKELKVNNAYFTVAVPEIYRNVHKAVCEAETTHIELGRLHPYFYEFG
                     RYLTPYDRNHVIGRIIFETLRQRVRHLLDISKSDGQAAKAEHRLDNIEAKLHEAGVRT
                     HSQYIEWLQMTGNKIRTSELVEEHQKKRRRADRSDDEGESLPNSKRATL"
     misc_feature    173..367
                     /gene="Psf3"
                     /note="beta-strand (B) domain of GINS complex protein
                     Psf3; Region: GINS_B_Psf3; cd21693"
                     /db_xref="CDD:412029"
     misc_feature    order(173..178,182..184,188..196,200..205,236..247,
                     314..319,326..331,347..349)
                     /gene="Psf3"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:412029"
     misc_feature    347..664
                     /gene="Psf3"
                     /note="Alpha-helical domain of GINS complex protein Psf3
                     (partner of Sld5 3); Region: GINS_A_psf3; cd11713"
                     /db_xref="CDD:212551"
     misc_feature    order(452..454,461..463,518..520,530..532,542..547,
                     590..592,599..601,605..607,611..643)
                     /gene="Psf3"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:212551"
     polyA_site      1213
                     /gene="Psf3"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tagttggtca ctttggagca ctgccaatcg cggtttcgat aggttttccc acccccacct
       61 cctccgcctt cgctggctgt tgtgcagccc tggcaaccgc gcaaacataa ataaatgctc
      121 ctcggttatt acatttatcc atttaaccgc cggcatgaac tactttccca actactactc
      181 catcgaggac atattcgtga cccaggagaa ggtggagtgc cgggtgaaca ccaagctgca
      241 gcggatggga ttcctggatt ctggagctga atccgatgat ttagagcccg gacggacggt
      301 caacctgccg ctgtggtaca tcaaggagct gaaagtgaac aatgcctact tcaccgtcgc
      361 cgtaccagaa atctatcgca acgtgcacaa ggccgtctgc gaggcggaga ccacccacat
      421 cgagctgggc cgcctgcatc cgtacttcta cgagttcggc cgctacctga cgccctacga
      481 ccgcaaccac gtcatcgggc gcatcatctt cgagacgctg cgccagcggg tgcgccacct
      541 gctcgacatc tccaagagcg acggccaggc ggccaaggcg gagcaccggc tggacaacat
      601 cgaggccaag ctgcacgagg cgggcgtgcg cacccacagc cagtacatcg aatggctgca
      661 gatgaccggc aacaagatcc gcacctcgga gctggtggag gagcaccaga agaagcggcg
      721 gcgggccgat cgcagcgatg acgagggcga gtccctgccc aacagcaagc gggccacctt
      781 gtgacctgga ccaacccatc ccaacataaa ctggtgtctt ggaactgtag caactttatt
      841 tcgtccattc tttttggtgg ccatagggca gcctcaactc tcaaaaatac acatcatcta
      901 cgcaatcggc tacagccatt tgtacggttc gaaaatacat acatgggttc atcgcataca
      961 catctacaca taactaagca tccgatctgg gggcccggtc ttaaactaat ctatttggag
     1021 ctgccggcac gcgctttaaa tggacctggc aataagccaa acaaccgcgc atccttatac
     1081 gattttgcgc cacattatta catataaata gttaactaca tatataatta taatcttgta
     1141 agctcaatta aaatttgatt ttgtgctagt ttcacataca tttcacaaat aaacattcac
     1201 caatgtcagc ata