Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii 6-phosphogluconolactonase (Pgls),


LOCUS       XM_017146804             850 bp    mRNA    linear   INV 09-DEC-2024
            mRNA.
ACCESSION   XM_017146804
VERSION     XM_017146804.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017146804.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..850
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..850
                     /gene="Pgls"
                     /note="6-phosphogluconolactonase; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:108060883"
     CDS             73..780
                     /gene="Pgls"
                     /codon_start=1
                     /product="probable 6-phosphogluconolactonase"
                     /protein_id="XP_017002293.2"
                     /db_xref="GeneID:108060883"
                     /translation="MSELKVNRSNSEEQLVQVVADLLKRCSQEALARQDKFSVGLSGG
                     SLIQLLTKALKSGALKTDKWLFFFCDERYVPLNDSDSTYGAYRAEWQTLLPSIRDSQF
                     VRADTTKPLDECAADYESKVKSQVDRFDLLLLGMGPDGHTCSLFPEQPATLQESQRLV
                     IPIRNSPKPPPERITFTLPLINNARDVAFVVTGAGKASVVKSVFVDLDKKFPAAWVNP
                     TQGQLTLIVDAGAGKEI"
     misc_feature    103..744
                     /gene="Pgls"
                     /note="Glucosamine-6-phosphate
                     isomerases/6-phosphogluconolactonase; Region:
                     Glucosamine_iso; pfam01182"
                     /db_xref="CDD:460101"
     polyA_site      850
                     /gene="Pgls"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 atagttggca acacgaaagg tgtgatttat tggaatcgaa gtcgagtcgg gtttcattat
       61 cagatcagca atatgtcgga gctaaaggtg aaccggtcca attcggagga gcaactggtc
      121 caggtggtgg ccgatctcct taagcgctgc tcccaggagg cgttggccag gcaggataag
      181 ttcagcgtgg gtctctcggg tggctccctc atccagctgc tgacaaaagc cctgaagtcg
      241 ggagctttga aaaccgacaa gtggctgttc ttcttctgcg acgagcgata tgtgcccctg
      301 aacgacagcg actccaccta cggagcctac agggccgagt ggcagaccct tttgccgagc
      361 atccgggact cgcagttcgt ccgggccgac accaccaagc cgctggacga atgcgccgcg
      421 gactacgagt cgaaggtcaa gagccaggtg gatcgcttcg atctcctgct gctgggcatg
      481 ggacccgacg gacacacctg ctccctcttc cccgagcagc cggccacgct gcaggaatcc
      541 cagcgcctgg tcatccccat ccggaactca cccaagccgc cgcccgagcg gatcaccttc
      601 accctgccgc tgatcaataa cgcccgggac gtagccttcg tggtcaccgg tgccggaaaa
      661 gccagtgtcg tcaagagtgt ttttgtcgat ctggacaaga agtttcccgc tgcctgggtg
      721 aatccgacac aaggacagtt gacgcttatt gtggacgcgg gagctggcaa ggaaatttga
      781 gccttataat gacatttcta cttagattat taacgaatct tgtaaataat aatatttttt
      841 atacaacttt