Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017146804 850 bp mRNA linear INV 09-DEC-2024 mRNA. ACCESSION XM_017146804 VERSION XM_017146804.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017146804.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..850 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..850 /gene="Pgls" /note="6-phosphogluconolactonase; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108060883" CDS 73..780 /gene="Pgls" /codon_start=1 /product="probable 6-phosphogluconolactonase" /protein_id="XP_017002293.2" /db_xref="GeneID:108060883" /translation="MSELKVNRSNSEEQLVQVVADLLKRCSQEALARQDKFSVGLSGG SLIQLLTKALKSGALKTDKWLFFFCDERYVPLNDSDSTYGAYRAEWQTLLPSIRDSQF VRADTTKPLDECAADYESKVKSQVDRFDLLLLGMGPDGHTCSLFPEQPATLQESQRLV IPIRNSPKPPPERITFTLPLINNARDVAFVVTGAGKASVVKSVFVDLDKKFPAAWVNP TQGQLTLIVDAGAGKEI" misc_feature 103..744 /gene="Pgls" /note="Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase; Region: Glucosamine_iso; pfam01182" /db_xref="CDD:460101" polyA_site 850 /gene="Pgls" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 atagttggca acacgaaagg tgtgatttat tggaatcgaa gtcgagtcgg gtttcattat 61 cagatcagca atatgtcgga gctaaaggtg aaccggtcca attcggagga gcaactggtc 121 caggtggtgg ccgatctcct taagcgctgc tcccaggagg cgttggccag gcaggataag 181 ttcagcgtgg gtctctcggg tggctccctc atccagctgc tgacaaaagc cctgaagtcg 241 ggagctttga aaaccgacaa gtggctgttc ttcttctgcg acgagcgata tgtgcccctg 301 aacgacagcg actccaccta cggagcctac agggccgagt ggcagaccct tttgccgagc 361 atccgggact cgcagttcgt ccgggccgac accaccaagc cgctggacga atgcgccgcg 421 gactacgagt cgaaggtcaa gagccaggtg gatcgcttcg atctcctgct gctgggcatg 481 ggacccgacg gacacacctg ctccctcttc cccgagcagc cggccacgct gcaggaatcc 541 cagcgcctgg tcatccccat ccggaactca cccaagccgc cgcccgagcg gatcaccttc 601 accctgccgc tgatcaataa cgcccgggac gtagccttcg tggtcaccgg tgccggaaaa 661 gccagtgtcg tcaagagtgt ttttgtcgat ctggacaaga agtttcccgc tgcctgggtg 721 aatccgacac aaggacagtt gacgcttatt gtggacgcgg gagctggcaa ggaaatttga 781 gccttataat gacatttcta cttagattat taacgaatct tgtaaataat aatatttttt 841 atacaacttt