Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017146801             729 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108060881), mRNA.
ACCESSION   XM_017146801
VERSION     XM_017146801.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017146801.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..729
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..729
                     /gene="LOC108060881"
                     /note="uncharacterized LOC108060881; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108060881"
     CDS             57..467
                     /gene="LOC108060881"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_017002290.2"
                     /db_xref="GeneID:108060881"
                     /translation="MNSIPGSIPLLSFLVILGACLAWSLPMNPDQQDREPVGQQYNGV
                     AKSESFVGRVAAKNQNINDHTAEDRALFDIVELRNDLEAAGVVSGDKRELHQLTYTEL
                     VRLLALWHLSQTRNVYEARGPEEQPDQALDTETR"
     polyA_site      729
                     /gene="LOC108060881"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cgacagacga ggcgacggca gtgccacggc aaagcttctc gcagtcggac gcaaacatga
       61 attccattcc gggcagcatt ccgctcctct cgttcctggt gatcctcggc gcctgcctgg
      121 cctggtcgct gcccatgaac cccgaccagc aggatcggga gccggtgggc cagcagtaca
      181 atggcgtggc gaagagcgag agtttcgtgg gcagagtggc ggccaagaat cagaacatca
      241 acgatcacac tgccgaggat cgggccctgt tcgatattgt ggagctgcga aacgatctgg
      301 aggccgccgg cgtggtgtcg ggcgataagc gggagctgca tcagctcacc tacacggaac
      361 tggtgcgact tttggccctg tggcacttgt cccagacccg caacgtctac gaggcccgag
      421 gacccgagga gcagcccgat caggccctcg ataccgagac ccgctaatgg gaaacgctct
      481 ctatgagtaa gctcgtttat taaagccaaa gttcagttga tagaaatgtg acgaagagaa
      541 aaaggctagt atgtatggga ataaatgata aatatatgat actccaagat cgatatgatg
      601 gcactttcgt aaataacaat gtaacttttt ctttttctat cacaattatt atctaaaaca
      661 tctataatgt tagagtgaac tatttagatt tgtataaaat tgctattaaa cttaaccgta
      721 ttggaaaaa