Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017146801 729 bp mRNA linear INV 09-DEC-2024 (LOC108060881), mRNA. ACCESSION XM_017146801 VERSION XM_017146801.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017146801.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..729 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..729 /gene="LOC108060881" /note="uncharacterized LOC108060881; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108060881" CDS 57..467 /gene="LOC108060881" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_017002290.2" /db_xref="GeneID:108060881" /translation="MNSIPGSIPLLSFLVILGACLAWSLPMNPDQQDREPVGQQYNGV AKSESFVGRVAAKNQNINDHTAEDRALFDIVELRNDLEAAGVVSGDKRELHQLTYTEL VRLLALWHLSQTRNVYEARGPEEQPDQALDTETR" polyA_site 729 /gene="LOC108060881" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cgacagacga ggcgacggca gtgccacggc aaagcttctc gcagtcggac gcaaacatga 61 attccattcc gggcagcatt ccgctcctct cgttcctggt gatcctcggc gcctgcctgg 121 cctggtcgct gcccatgaac cccgaccagc aggatcggga gccggtgggc cagcagtaca 181 atggcgtggc gaagagcgag agtttcgtgg gcagagtggc ggccaagaat cagaacatca 241 acgatcacac tgccgaggat cgggccctgt tcgatattgt ggagctgcga aacgatctgg 301 aggccgccgg cgtggtgtcg ggcgataagc gggagctgca tcagctcacc tacacggaac 361 tggtgcgact tttggccctg tggcacttgt cccagacccg caacgtctac gaggcccgag 421 gacccgagga gcagcccgat caggccctcg ataccgagac ccgctaatgg gaaacgctct 481 ctatgagtaa gctcgtttat taaagccaaa gttcagttga tagaaatgtg acgaagagaa 541 aaaggctagt atgtatggga ataaatgata aatatatgat actccaagat cgatatgatg 601 gcactttcgt aaataacaat gtaacttttt ctttttctat cacaattatt atctaaaaca 661 tctataatgt tagagtgaac tatttagatt tgtataaaat tgctattaaa cttaaccgta 721 ttggaaaaa