Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii ATP synthase membrane subunit K,


LOCUS       XM_017146773             446 bp    mRNA    linear   INV 09-DEC-2024
            mitochondrial (Neb-cGP), mRNA.
ACCESSION   XM_017146773
VERSION     XM_017146773.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017146773.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..446
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..446
                     /gene="Neb-cGP"
                     /note="ATP synthase membrane subunit K, mitochondrial;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 3 Proteins"
                     /db_xref="GeneID:108060864"
     CDS             141..287
                     /gene="Neb-cGP"
                     /codon_start=1
                     /product="ATP synthase membrane subunit K, mitochondrial"
                     /protein_id="XP_017002262.1"
                     /db_xref="GeneID:108060864"
                     /translation="MAGEGEKLTGLSKIFNGTTMSGRANVAKATYAVMGLLIAYQVLK
                     PKKK"
     misc_feature    141..281
                     /gene="Neb-cGP"
                     /note="ATP synthase regulation; Region: ATP_synth_reg;
                     pfam14960"
                     /db_xref="CDD:434349"
     polyA_site      446
                     /gene="Neb-cGP"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 atcgagtgtt tgagattttt tagggggaag gctgaatttt catctggcaa cactgtctag
       61 tcagttgtat aacctttcgc cgcaaatatt ttttctggcc actgcagcag ctcgaattcc
      121 gtgcaaataa accccaagaa atggctggcg agggcgagaa actgaccggt ctgtcgaaga
      181 tcttcaatgg caccaccatg agcggccgtg ctaacgtggc caaggccacg tacgccgtga
      241 tgggcctgct gatcgcctac caggtgctga agcccaagaa gaagtagggc tcctgctcct
      301 ccgcctctca tccgccgcat cggaagttct ggatccggaa atcccggagg acgcaccgcc
      361 gtcgccgctg gactccggat cagtttattt tatgtgtagt gcaagacctt gaaggaataa
      421 ataagctgag aatgtaacac actgaa