Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017146773 446 bp mRNA linear INV 09-DEC-2024 mitochondrial (Neb-cGP), mRNA. ACCESSION XM_017146773 VERSION XM_017146773.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017146773.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..446 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..446 /gene="Neb-cGP" /note="ATP synthase membrane subunit K, mitochondrial; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108060864" CDS 141..287 /gene="Neb-cGP" /codon_start=1 /product="ATP synthase membrane subunit K, mitochondrial" /protein_id="XP_017002262.1" /db_xref="GeneID:108060864" /translation="MAGEGEKLTGLSKIFNGTTMSGRANVAKATYAVMGLLIAYQVLK PKKK" misc_feature 141..281 /gene="Neb-cGP" /note="ATP synthase regulation; Region: ATP_synth_reg; pfam14960" /db_xref="CDD:434349" polyA_site 446 /gene="Neb-cGP" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 atcgagtgtt tgagattttt tagggggaag gctgaatttt catctggcaa cactgtctag 61 tcagttgtat aacctttcgc cgcaaatatt ttttctggcc actgcagcag ctcgaattcc 121 gtgcaaataa accccaagaa atggctggcg agggcgagaa actgaccggt ctgtcgaaga 181 tcttcaatgg caccaccatg agcggccgtg ctaacgtggc caaggccacg tacgccgtga 241 tgggcctgct gatcgcctac caggtgctga agcccaagaa gaagtagggc tcctgctcct 301 ccgcctctca tccgccgcat cggaagttct ggatccggaa atcccggagg acgcaccgcc 361 gtcgccgctg gactccggat cagtttattt tatgtgtagt gcaagacctt gaaggaataa 421 ataagctgag aatgtaacac actgaa